KEGG   Enterococcus faecalis V583: EF0668Help
Entry
EF0668            CDS       T00123                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
efa  Enterococcus faecalis V583
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:efa00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:efa00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(618596..620122)
Genome map
AA seq 508 aa AA seqDB search
MTISLFAIRDCLEKEDLLKEFISPEGWHLTLSDTLGQREVTALSYDSRDVTAETLFFCKG
LNFKEIYLENAVKDGLEIYVSEVPYEVPAQLGIIVTDIKKAMAVLSMAFYDYPQNKLKLI
GFTGTKGKTTAAYFTKYILDVATQQKTALLSTMNSTLDGKTFFKSALTTPESLDLYRMMA
TAVANGMTHFIMEVSSQAYKTNRVYKLFFDVGIFLNITPDHISPIEHPTFDDYFYCKRQL
ITHSKVIVLNHEADYFPLLKETAQQQKVPAIVYGSQPAPEVDYSFAVSSEDSLRFIVESP
ADALGLAGSYHLRLGGDFNKGNALSAAIASVLVGASKEECQQGIAATTVPGRMESLTNTN
GATVYVDYAHNYDSLKNLLTFVREEHPDGRLIVLVGSTGDKAISRRKDFGRVLSELADVA
VLTTDDPASEDPAKICQEIQAHITKEMPVYTVLDRGEAIAHALSLSTTADDAIVLAGKGA
DLYQKVNGVDEPYAGDFALAEAFINKKN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatttcattattcgcaattcgcgattgcttagaaaaagaagatttattaaaagaa
tttatttcaccagaaggctggcacttgactctttccgacacgttaggtcaacgagaagta
acggctctttcttacgattcgagagacgtaacagcagaaacactctttttttgtaaagga
ttaaactttaaagaaatctatttagaaaatgctgtaaaagacggcctagaaatctatgtt
tctgaggtgccttatgaggttccggcgcaactaggaattatcgtgactgacattaaaaaa
gcaatggctgtgttaagcatggctttttatgattatccacaaaataaattaaaactgatt
ggctttactggaaccaagggtaaaacaacagcggcttatttcaccaaatatattttagat
gttgctacacaacaaaaaacagccttgctttctaccatgaattcgacattagatggcaaa
acattctttaaatctgccttgactacacccgaatctttggacttgtatcgaatgatggca
accgctgttgctaacgggatgactcattttattatggaagtttcttcccaagcctacaaa
actaatcgtgtctacaagttattttttgatgtcggcatttttttaaacattacccccgac
catatcagtccaattgaacatccaacctttgacgattacttttattgcaaacgtcaattg
attacacattctaaagtcattgtgttgaatcacgaagctgattattttccattacttaaa
gaaactgcacaacagcaaaaagtcccagccattgtctatggcagtcagccggctccagaa
gtagactattcattcgctgtttcttcagaggattccttacgttttatcgttgaaagtcct
gcagatgcgttaggattggccggctcttatcaccttcgtttaggtggtgattttaacaaa
ggtaatgcgttaagtgcggcgattgctagtgtccttgtgggagcttcaaaagaagagtgt
caacaaggaatcgcagcaaccaccgtccctggccggatggaatctttaacgaataccaac
ggtgcaaccgtctatgttgattacgctcataactatgacagtttgaagaatcttttaacc
tttgtccgtgaagaacatcctgacggccgcttaattgttcttgtcggtagcacgggagac
aaagcgatttctcgccgcaaagactttggtagggttctttctgaattggctgatgttgca
gtcctaacaaccgatgacccagccagtgaagatccagcaaaaatttgccaagaaattcaa
gcccatattaccaaagaaatgcctgtttacaccgttttagatcgtggcgaagcaattgct
cacgcattatctttaagcacaacggctgatgatgcgattgtcttagctggtaaaggcgcc
gacctttatcaaaaagtaaacggcgtagatgaaccttacgcaggagactttgcccttgcg
gaagctttcattaataaaaagaactaa

DBGET integrated database retrieval system