KEGG   Enterococcus faecalis V583: EF0813Help
Entry
EF0813            CDS       T00123                                 

Definition
glycosyl hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
efa  Enterococcus faecalis V583
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:efa00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:efa00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
774465..776243
Genome map
AA seq 592 aa AA seqDB search
MQTFEIKEDFLLNGQPIKIISGAIHYFRMTPSQWEDSLYNLKALGANTVETYIPWNIHEP
EEGVYDFEGMKNIEAFVRLAEKLNLLVILRPSAYICAEWEFGGLPAWLLKEKGVRLRSTD
PIFMTKVRNYFQVLLPKLAPLQITQGGPVIMMQVENEYGSYGMEKAYLRQTKQIMEELGI
EVPLFTSDGAWEEVLDAGTLIEEDVFVTGNFGSHSKENAAVLKKFMTRHGKKWPLMCMEY
WDGWFNRWGEPVIQREGTDLAKEVKDMLAVGSLNLYMFHGGTNFGFYNGCSARGAKDLPQ
VTSYDYDALLTEAGEPTEKYYAVQKAIKEVCPEVWQAQPRTKKLGNLGSFPVTASVSLFA
VKDQMMTPKTTTYPLSMEEAGSGYGYLLYSFDLKNYHHENKLKVVEASDRLHIYVDGDLA
ATQYQETVGEELLISGQTEKDTLALDILVENLGRVNYGFKLNNPTQSKGIRGGVMQDIHF
HQGYQHYPLTFSQEQLAKIDYTAGKNPLQPSFYQVTFELEQLADTYIDCRGYGKGFVVVN
GHHLGRYWEIGPIHSLYCPKEFLQQGQNEVVIFETEGIEIEYLKFTNQVIID
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgtttgagattaaagaagactttttattaaatggacaaccaataaaaattatt
agcggggcgattcattactttcgaatgacacctagccaatgggaagatagcctctataat
ctgaaagctttaggagctaatacagtagaaacctacattccttggaatattcatgaacca
gaagaaggcgtatacgattttgaaggaatgaaaaacattgaagcatttgtccgcttggca
gaaaaactgaatttactagttattctgcgtccttcggcttatatttgtgcagaatgggag
tttggtggcttaccagcatggcttttgaaagaaaaaggtgtgcgattacgttcgacagat
cctatttttatgactaaagttcgtaactattttcaagtattattgcctaaactagcaccg
ctgcagataacacaaggtggaccagtgatcatgatgcaggttgaaaatgaatatgggtcc
tatggcatggagaaagcgtacttgcgacaaaccaagcagataatggaagaactggggatt
gaggttcctctttttacatctgatggcgcttgggaagaggttttggatgcgggtacgtta
attgaagaggatgtttttgtgacaggaaattttggtagtcattcgaaagaaaatgctgcc
gttttgaaaaaatttatgactcgtcatggtaaaaaatggccgttgatgtgcatggaatac
tgggatgggtggttcaatcgttggggcgaaccagtgattcagcgggaaggtaccgacttg
gcgaaagaagtaaaagatatgctggcagtgggttctttaaatctctatatgtttcatgga
ggaacaaatttcggcttttataacgggtgttcggcgcgaggtgcaaaagatttacctcaa
gtcactagctatgattatgatgctttattaacagaagcaggagaaccaacagaaaaatat
tatgccgttcaaaaagcaattaaagaagtatgtccagaagtttggcaagcacaaccacgc
acgaaaaaactggggaatttaggaagctttccagtaactgctagcgtatccttattcgca
gtaaaagatcaaatgatgacaccgaagaccaccacgtatccattaagtatggaagaagct
ggctcaggctatggctacttgctttattcgtttgatttaaaaaattatcatcatgaaaat
aaactaaaagtggtcgaggccagtgatcgtttacacatttatgtagatggagatttagct
gctacccaatatcaagagacagtgggagaagagctactcatttcagggcaaactgaaaaa
gacacacttgcgttagatatcctagtggaaaacttaggtcgcgttaattatggctttaaa
ttaaataatcccacacaaagtaaaggaattcgaggtggagtgatgcaagacattcatttt
caccaaggctatcaacactatcccttaactttttcacaagagcaattagccaagattgat
tacacagctggaaaaaatccattgcagccttcgttttatcaagtaacatttgaattagaa
cagctagcagacacgtatattgactgtcgaggctacggcaaaggattcgttgtggtcaat
ggccatcatctaggtcgttattgggaaataggacccattcattcgctgtattgtcccaaa
gaatttttacagcaaggacaaaatgaagtagtaatttttgaaacagagggaattgaaatt
gagtacttgaaatttacgaatcaagtaatcatagattaa

DBGET integrated database retrieval system