KEGG   Enterococcus faecalis V583: EF0900Help
Entry
EF0900            CDS       T00123                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
efa  Enterococcus faecalis V583
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EF0900 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF0900 (adhE)
   00620 Pyruvate metabolism
    EF0900 (adhE)
   00650 Butanoate metabolism
    EF0900 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    EF0900 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EF0900 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EF0900 (adhE)
   00626 Naphthalene degradation
    EF0900 (adhE)
Enzymes [BR:efa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EF0900 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EF0900 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
864152..866698
Genome map
AA seq 848 aa AA seqDB search
MIDELATKANVALKAMEDFTQEQVDHIVHQMAMAALDQHMPLAKMAVEETGRGIYEDKAI
KNMYASEYIWNNIKHDKTVGVINKDEQTGLMEIAEPVGVVCGVTPTTNPTSTTIFKSLIA
LKTRNPIVFAFHPSAQKCSAEAARIVRDAAIAAGAPENCIQWIEQPSIDATSALMNHPGI
AIVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIEKTAKVKRAVNDLIVSKSFDNGMICA
SEQAVIVDKEIYASVKAEFEAHNVYFVKPNELQKLEDAVMNEGKYAVNPAIVGNSAEKIA
ELAGISVPKGTKILVAELEGAGPEYPLSREKLSPVLAMMKSNNAEHAFELCEAMLNLGGL
GHTAVIHTEDEELQVAFGLRMKACRILVNTPSAEGGIGNIYNEMIPSLTLGCGSYGKNSV
SKNVSAINLINIKTVAKRRNNMQWFKLPPKIFFEKNSLQYLQKMENVERVMLVCDPGMVQ
FGYADIVRKELQKRKNDVKIEVFSDVEPNPSTNTVYAGTKMMVDFQPDTVIALGGGSAMD
AAKGMWMFYEHPDTEFFGAKQKFLDIRKRTYKIAKPEKTQFVCIPTTSGTGSEVTPFAVI
TDSETHVKYPLADYALTPDVAIVDPQFVMSVPASVTADTGMDVLTHAIESYVSVMASDYT
RGLSLQAIKLVFDHLENSVKRPDMESREKMHNASTMAGMAFANAFLGICHSIAHKIGGEY
GIPHGRTNAILLPHIIRYNAKDPSKHAMFPKYDYFRADTDYADIAKFLGLKGNTTAELVE
ALATAVADLGKSVGIDMNLKAQGVSQETLDTTVDRMAELAYEDQCTTANPKEPLISELKQ
IILDAYVG
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgaattagcaacaaaagcgaatgtcgctttaaaagcaatggaagattttaca
caagaacaagtagatcacattgtccatcaaatggcgatggcggcgttagaccaacatatg
cctttagcaaaaatggctgtcgaagaaactggccgtggaatctatgaagataaagcaatc
aaaaatatgtatgcatctgaatacatttggaataatattaaacatgataaaacagtgggt
gtaattaacaaagacgaacaaaccggcttaatggaaattgctgagccagttggcgtggta
tgtggggtcacaccaacaacgaacccaacgtcaacaactatttttaaatcactaattgcc
ttaaaaacaagaaatccaattgtttttgctttccatcctagcgcacaaaaatgttcggca
gaagcggcacgtattgtacgggatgcggcgattgcagcaggtgcaccagaaaattgtatt
caatggattgaacaaccatcgattgatgcaacatctgctttgatgaatcatccagggatt
gccattgttttagcaactggtggcgcaggcatggtaaaatctgcgtactcaacaggtaaa
ccagcactaggcgttggtcctgggaacgtaccagcttatattgaaaaaacagctaaagta
aaacgtgcggttaatgatttaattgtttcaaaatcatttgataatggaatgatttgtgct
tctgagcaagcggtcattgtggataaagaaatttatgcttctgtcaaagctgagtttgaa
gcacacaatgtttacttcgtgaaaccgaatgaattacaaaaactagaagatgcagtgatg
aatgaaggcaaatacgcagtaaatccagcgattgtcggtaactctgcagaaaaaattgct
gaattagcaggaattagtgtaccaaaaggcacaaaaattttagtcgctgaattagaaggt
gcaggtccagaatatccattatcaagagaaaaattatcgccagttttagcaatgatgaaa
tcaaacaatgcagagcatgcttttgaactatgtgaagcgatgttaaacttaggtggttta
ggacatacagcagtaattcatacagaagatgaagagttacaagttgcttttggtttacgt
atgaaagcttgtcgtattttagtgaatactccatcagcagaaggcggtatcggtaacatt
tataacgaaatgattccatccttaacacttggttgtggttcatacgggaaaaactctgtt
tctaaaaacgtatcagccattaacttaattaatattaaaacggtagcgaaacggagaaat
aatatgcaatggtttaaattacctccaaaaattttctttgaaaaaaattctttacaatat
ctacaaaaaatggaaaatgttgaacgtgtcatgttagtttgtgacccaggtatggttcaa
tttggctatgcagatatcgtacgtaaagagctacaaaaacgtaaaaatgatgtgaaaatc
gaagtattttctgatgttgaaccaaacccatcaacaaatactgtttatgcaggtaccaaa
atgatggttgatttccaaccagatacagtgattgccttgggtggcggttctgcaatggat
gcggcgaaaggaatgtggatgttctatgaacacccagatacagagttctttggtgcaaaa
caaaaattcttagatatccgcaaacggacatataaaattgccaaaccagaaaaaacacaa
tttgtttgtatcccaactacttcaggaactggttcagaagttacaccatttgccgttatt
actgatagtgaaacacacgtgaaatatccgttagcagactatgcgttaacaccagatgta
gcgattgttgatccacagttcgtaatgtctgtgccagcttcagtcactgcagatacaggt
atggatgttttaacacatgctattgaatcttatgtttccgtgatggcttcagattacaca
cgtggtttaagtttacaagcaatcaagttagttttcgatcatttagaaaattcagtgaaa
cgtccagatatggaatctcgcgaaaaaatgcataatgcatcaaccatggcagggatggca
tttgccaatgcattcttaggtatttgtcactctattgctcataaaattggtggggaatat
ggcattccacatggtcgtacaaatgcgattttattaccacatattattcgttacaatgcg
aaagatccatcaaaacacgcaatgttccctaaatatgattacttccgcgccgatactgat
tatgcagacattgcaaaattcttaggcttaaaaggaaatactaccgcagaactagtagaa
gctttagcaacagcagtagcagatttaggtaaatcagtcggaattgacatgaacttgaaa
gcccaaggtgtctcacaagaaacattagacacaacggttgatcgtatggcagaacttgca
tatgaagaccaatgtacaactgcaaatccgaaagaaccattaattagtgaactaaaacaa
attatcttagatgcttatgtaggataa

DBGET integrated database retrieval system