KEGG   Enterococcus faecalis V583: EF1020Help
Entry
EF1020            CDS       T00123                                 

Definition
(RefSeq) glycosyl hydrolase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00010  Glycolysis / Gluconeogenesis
efa00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF1020
   00500 Starch and sucrose metabolism
    EF1020
Enzymes [BR:efa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EF1020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase QIL1
Motif
Other DBs
NCBI-GeneID: 1199907
NCBI-ProteinID: NP_814754
UniProt: Q836T7
Position
977426..978820
Genome map
AA seq 464 aa AA seqDB search
MKYQFPENFWWGSAASGPQTEGVFEGDGKGQNIWDFWYQEAPEKFFQQVGPDKTSQFYKK
YQEDIQLMKETGHNSFRTSIQWSRLIPDPTTGKVNQTAVDFYNQVIDDLLEHGIEPFMNL
YHFDMPMVLQEKGGWESREVVDLYVDFAKTCFELFGDRVKKWFTHNEPIVPVEGGYLYGW
HYPDKVNLKEGIQVLYHEALASAKAIAVYHSMNLSGEIGIILNLTPTYPRDEHNEADVNA
AKFVDGFFNRSFLDPAVKGHFPEDMVAWAKANDLLPETTPEDLAIIAENTVDLLGVNYYQ
PRRAKAKETPVETRPEGLLPEDFYDVYDMPGKKMNPYRGWEIYEKGIYDTLMNLKENYGN
IRCYISENGMGVEGEERFVNEQGVIEDDYRIEFVQDHLKWVHQAIQEGSNVQGYHMWTCM
DNWSWLNAYKNRYGFIAVDLDDDAKRTIKKSGRWFKEMTANNGF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcaatttccagaaaatttttggtggggttctgcagccagcggtcctcaaaca
gaaggcgtttttgaaggtgatggtaaaggtcaaaatatttgggatttttggtatcaagaa
gcgccagaaaaattttttcaacaagtcggtccagataagacctcacaattttataaaaaa
taccaagaagatattcagttaatgaaagaaacgggacataactcttttcgaacatccatt
caatggagccgtttaattccagatcctacaacagggaaagtcaatcaaacagcagttgat
ttttataatcaagtcattgatgatttattagaacacgggattgagccctttatgaacttg
tatcattttgatatgccgatggtacttcaagaaaaaggcggttgggaaagccgtgaagta
gttgatttgtatgttgactttgccaaaacctgttttgaattgtttggcgatcgcgtgaaa
aaatggtttacgcacaatgaaccaattgtaccagttgaaggtggttatctctatggctgg
cattatcctgataaagtgaatctaaaagaagggattcaagtactctatcatgaagcttta
gctagtgccaaagcgattgccgtctatcactctatgaacttatcaggtgaaattggcatt
attttaaacttaacgccgacttatcctcgtgatgagcacaacgaagccgatgtaaatgcg
gctaaatttgtcgatggtttctttaaccgttcgtttttagacccggctgttaaaggtcat
tttccagaagatatggttgcttgggcgaaagcaaatgacttattgccagaaacaacgcca
gaagatttagcaataattgctgaaaatactgtggacttattaggagtaaactactatcaa
ccacgtcgtgccaaagcaaaagaaacacctgttgaaacacgaccagaaggcttacttcca
gaagatttttatgatgtctacgatatgcctggcaaaaaaatgaatccttaccgtggctgg
gaaatctacgaaaaaggtatttatgatacattaatgaatttaaaagaaaattatggcaac
attcgctgctacatttcagaaaatggcatgggcgtagaaggagaagaacgctttgtcaat
gaacaaggagtcattgaagatgattatcggattgaattcgtgcaagatcacttgaaatgg
gtgcaccaagcgattcaagaaggtagtaatgttcaaggatatcatatgtggacgtgtatg
gataactggtcttggctcaatgcctataaaaatcgttatggcttcatcgctgtggattta
gatgatgatgcgaaacggaccattaagaaaagcggtcgttggttcaaagaaatgacagca
aataacggcttttag

DBGET integrated database retrieval system