KEGG   Enterococcus faecalis V583: EF1243Help
Entry
EF1243            CDS       T00123                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efa  Enterococcus faecalis V583
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF1243
Enzymes [BR:efa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EF1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1213415..1214848
Genome map
AA seq 477 aa AA seqDB search
MEHHQLKAFPQDFLWGSASAAYQVEGAWNEDGKGASVWDEFVRLPGKTFKETTGDLAVDH
YHRFKEDVALMKQQGLKAYRFSIAWTRILPEGRGRVNQAGLKFYSDLIDELLAAGIEPMV
TLYHWDLPAVLQKEYGGWESRKIIDDFVAYAKILFDAFRGKVRYWISLNEQNVFTSLGYQ
LAVHPPGVTDNKRMYEANHIANLANAAVINAFHELEMPGKIGPSFAYTPVYAVDAHPANV
LAAENAEDLLSHFWLDVYLWGEYPIAALNYLQEQGVAPTIKEGDLALLRSAKPDFLGINY
YRTDTVAANPLDGVGIGKMNTTGEKGSETESGVPGLFKKVNNPYVERTNWDWAIDPQGLR
IALRRLASRYQVPILITENGLGEYDTLTEDKQIHDTYRIDYLRSHIQAIQEAITDGVSVI
GYCTWSYTDLLSWLNGYQKRYGFVYVDQDETQKGSLERIPKDSYYWYQKVIETNGLI
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcatcaactaaaagcatttccgcaagattttttatggggctctgcttcggca
gcttatcaagtggaaggtgcttggaatgaagacggcaaaggcgcatctgtttgggatgaa
tttgttcggctaccaggaaaaacgttcaaagagacaactggcgatttagccgtcgatcat
tatcatcgtttcaaagaagatgtggctttaatgaaacaacaaggtttaaaagcatatcgt
ttctcgattgcatggacacgaattttacctgaagggcgtggtcgagtaaatcaagcggga
ctgaaattttattcagatttaattgatgagttattagcggcaggaattgaaccaatggta
actttgtatcattgggatttgccagctgttttgcaaaaagaatatggtggctgggaatca
agaaaaattattgatgattttgtggcctatgcgaaaattttatttgacgctttccgtggc
aaagttcgctattggattagtttaaatgaacaaaatgtgtttacttcgttaggttatcaa
ttagccgtgcatcctcccggcgtaacagataataaacggatgtatgaggccaatcatatt
gctaatttagccaatgcagcagtgattaatgcgtttcatgaattagaaatgcctggcaaa
attggccctagctttgcttatacgcctgtttatgccgttgatgcgcatcctgccaatgtt
ttggcggcagaaaatgcagaagatttgttgtcgcatttttggttagatgtctatctttgg
ggagaatacccaattgccgcattaaattacttacaggagcaaggtgtggccccaacgata
aaagagggcgatttagcgttactacgttcagccaaacctgattttctaggtattaattat
tatcggacggatacggttgctgctaatccattagatggcgtcggaatagggaagatgaat
acaacgggtgaaaagggttctgaaacggaatctggggtaccgggtttatttaaaaaagta
aataatccatatgttgaacggacgaactgggattgggccattgacccgcaaggtttgaga
attgccttacgacgattagctagtcgctatcaagtccctattttaattactgaaaatggg
ttaggcgaatatgataccttaacagaagataaacaaattcatgatacgtatcgcattgat
tatttgcgaagccatatccaagcgattcaagaggcgattacggatggtgtttcagttatt
ggttattgtacatggagttacaccgatttactgtcgtggctcaacggctatcaaaagcgt
tatggttttgtctatgtggatcaagatgaaacacaaaaaggttccttagaaagaatcccg
aaagacagttattattggtatcaaaaagtcattgaaacaaatggacttatctaa

DBGET integrated database retrieval system