KEGG   Enterococcus faecalis V583: EF1355Help
Entry
EF1355            CDS       T00123                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00010  Glycolysis / Gluconeogenesis
efa00020  Citrate cycle (TCA cycle)
efa00620  Pyruvate metabolism
efa01100  Metabolic pathways
efa01110  Biosynthesis of secondary metabolites
efa01120  Microbial metabolism in diverse environments
efa01130  Biosynthesis of antibiotics
efa01200  Carbon metabolism
Module
efa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF1355 (aceF)
   00020 Citrate cycle (TCA cycle)
    EF1355 (aceF)
   00620 Pyruvate metabolism
    EF1355 (aceF)
Enzymes [BR:efa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EF1355 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_3 HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-GeneID: 1200255
NCBI-ProteinID: NP_815076
UniProt: Q835M2
Position
1329130..1330749
Genome map
AA seq 539 aa AA seqDB search
MAYQFKLPDIGEGIAEGEIVKWFVKPGDTINEDDTLLEVQNDKSVEEIPSPVTGTVKNIV
VPEGTVANVGDVLIEIDAPGHEDNDAAPAAPAQEQTPAQPAAVPTTEAAGGFFQFKLPDI
GEGIAEGEIVKWFVKAGDTINEDDSLLEVQNDKSVEEIPSPVTGTVKNIVVPEGTVANVG
DVLVEIDAPGHNSAAPSVAAPATDAPKAEASAPAASTGVVAAADPNKRVLAMPSVRQYAR
EKDVDITQVTATGKGGRVIKADIDAFVSGGSQAAPATEAAATEAAPKAEAAAPKAAPKAF
TSDLGEMETREKMTPTRKAIAKAMVNSKHTAPHVTLHDEVEVSKLWDHRKKFKDVAAANG
TKLTFLPYVVKALTSTVQKFPILNASIDDAAQEIVYKNYFNIGIATDTDHGLYVPNVKNA
NTKSMFAIADEINEKAALAIEGKLTAQDMRDGTITISNIGSVGGGWFTPVINYPEVAILG
VGTIAQEPVVNADGEIVVGRMMKLSLSFDHRIVDGATAQKAMNNIKRLLADPELLLMEG
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcagtttaaattaccggatatcggtgaagggattgccgaaggcgaaatcgtt
aaatggtttgtaaaacctggcgatacaatcaacgaagacgatacgttattagaagtacaa
aatgacaaatcagtggaagaaattccatcaccagtaacaggtactgtaaaaaatatcgtt
gtaccagaaggaacagttgcaaacgttggtgacgtgttaatcgaaatcgacgcacctggt
cacgaagataacgatgcagcaccagcagctcctgcacaagaacaaacaccagcacaacct
gctgctgtaccaacaaccgaagcagctggcggatttttccaattcaaattaccagacatc
ggtgaaggaattgccgaaggcgaaatcgttaaatggttcgttaaagcgggcgacacaatt
aatgaagatgattcattattagaagtacaaaatgacaaatcagtagaagaaattccatca
ccagtaacaggtactgtaaaaaatatcgttgtaccagaaggaacagttgccaatgtgggt
gacgtgttagttgaaattgacgcacctggtcataattcagcagcaccgtcagtcgcagca
ccagctactgacgctcctaaagcggaagcatcagctccagccgcttcaacaggcgtagtt
gcagccgctgatccaaacaaacgcgttttagcaatgccatctgttcgtcagtatgcgcgt
gaaaaagacgttgatattacacaagtaactgcaactggtaaaggtggccgtgtcattaaa
gcggatattgatgcctttgtctctggtggttctcaagcagccccagctactgaagctgcc
gcaacagaagcagcacctaaagcggaagcagctgcacctaaagcagcgccaaaagccttt
acttctgatttaggcgaaatggaaacacgtgaaaaaatgacaccaacacgtaaagcaatt
gctaaagcaatggttaacagcaaacacactgctcctcacgtaacattacatgatgaagta
gaagtttctaaattatgggatcaccgtaagaaatttaaagatgttgctgctgcaaatggt
acaaaattaacattcttaccatacgttgtaaaagcattgacttcaactgttcaaaaattc
ccaatcttgaatgcatcaatcgatgacgcagcacaagaaattgtttacaaaaattacttt
aacattggtatcgctactgatacagatcatggcttatatgtaccaaatgttaaaaatgct
aatacgaagagcatgtttgctatcgctgatgaaatcaacgaaaaagcagcattggctatc
gaaggtaaattaactgcacaagatatgcgtgatggtacaatcacaattagtaacattggt
tcagtcggtggcggctggtttacaccagtaatcaactaccctgaagttgctattttaggc
gttggtacaattgcacaagaaccagttgttaatgcagacggcgaaatcgttgtgggacgc
atgatgaaattatcattaagctttgaccaccgtatcgttgacggcgcaactgctcaaaaa
gcaatgaacaacattaaacgcttattagctgatccagaattactattaatggaaggatga

DBGET integrated database retrieval system