KEGG   Enterococcus faecalis V583: EF1503Help
Entry
EF1503            CDS       T00123                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00010  Glycolysis / Gluconeogenesis
efa00030  Pentose phosphate pathway
efa00051  Fructose and mannose metabolism
efa00680  Methane metabolism
efa01100  Metabolic pathways
efa01110  Biosynthesis of secondary metabolites
efa01120  Microbial metabolism in diverse environments
efa01130  Biosynthesis of antibiotics
efa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF1503
   00030 Pentose phosphate pathway
    EF1503
   00051 Fructose and mannose metabolism
    EF1503
  Energy metabolism
   00680 Methane metabolism
    EF1503
Enzymes [BR:efa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     EF1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-GeneID: 1200406
NCBI-ProteinID: NP_815224
UniProt: Q834X4
Position
complement(1457575..1459455)
Genome map
AA seq 626 aa AA seqDB search
MATLNRDQQIEEIINLEAILNLPKGTEHFVSDLHGEFEAFDHILRNGSGRIREKVQFLFK
QELNAHQMDELCFIIYYPEEKLTLLENESALSYEWWLLTIRRLVEIVRSSSMKYTRSKVR
KALPETYGYILEELIYQYDETTTKNGYYQQIIEKIILLGEAKRFVTELAYLIQRLIIDHL
HVIGDIYDRGPAPDKIMDRLMSYHSLDIQLGNHDMIWLAAYSGSLACLANVVRICARYGN
LDLLEERYAIDLTALKKFSLETYKENPAFAPKKNPYRALTEAEKQVAMRVQQAIAIIQEK
LEGQIIGRRPDFNLAHRLRLDKIQGETITFDECRYTLINSCFQTVSEEQPYQLTREEKQI
IDDLLTQFQSSPRLTKHMRFLMEKASLYLVYNQNLLIHGCLPLNADGTFQAYTFKGHSYS
GKALVDFFQEMLEEAYAQPASTDDYATDCLWYLWCGEGSSLFGKRAMKTFERYFLAEKET
HYEEKNPYYSLRDTVEVCERILDEFEVTGENRHIINGHTPVKRTKGESPIKANGTLLVID
GGFSKSYQTITGIAGYTLLYNSFGLQLTAHKSFSSKETAILNNQDIHSIKQVIDRPLQRL
LVKDTTIGKELLKQSQALQKQMKQNQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
ttggctacactgaaccgcgatcaacaaattgaagaaattattaatttggaagcaattttg
aatttaccgaaaggaacagaacattttgtcagtgatttacatggtgaatttgaagctttt
gaccatattttaagaaatggttctgggcgaatccgagaaaaagttcaatttttatttaaa
caagaattaaatgcccatcagatggacgagctttgttttattatctactatccagaagaa
aaattaacacttttagaaaatgaaagcgccctctcttatgaatggtggctattaacgatt
cgccgtctggttgaaatcgtccgttcttcttcgatgaagtacacacgttctaaagttcgc
aaagcccttcctgaaacctatgggtatattctcgaagaattgatttatcaatatgatgaa
acaacaaccaaaaacggttactatcaacaaattattgaaaaaattattttactaggtgaa
gccaaacgtttcgtaacagaattagcttatctaatccaacgtctgattatcgatcaccta
catgttattggggatatctatgaccgggggccagcaccagataaaattatggatcgatta
atgtcctatcactccttggatattcaactaggcaatcatgatatgatttggctggctgct
tatagtggttcactggcttgtttagccaatgtagtacgtatttgtgctcgctatggaaat
ttagatttgttagaagaacgttatgctatcgatttaaccgccttaaaaaaatttagttta
gaaacgtataaagaaaatcctgcttttgcacccaagaaaaatccctatcgtgcgttaact
gaagctgaaaaacaagtagcgatgcgtgtgcaacaagccattgccattattcaagaaaaa
ctagaaggccaaattattggtcgacgccctgattttaacttggcacatcggctacgctta
gataagattcaaggggaaactattacttttgacgaatgtcgttatacattaattaacagc
tgtttccaaaccgtttctgaagagcaaccttaccaattaacacgtgaggaaaaacagata
attgatgatttattaacgcaatttcagtcttcaccgcggttaacaaaacacatgcgcttt
ctaatggaaaaagcttctctttaccttgtgtataatcaaaatttattgattcatggctgt
ctgcctctgaatgcggacggtacttttcaagcttatacatttaaaggccactcctattca
ggaaaagctttagttgacttctttcaggaaatgttagaagaagcttacgctcagcctgct
agtacagatgactatgcaacagattgtttatggtatctttggtgtggcgaaggttcctca
ttatttggtaaacgagctatgaaaacctttgagcgttattttctcgctgaaaaagaaaca
cattacgaagaaaagaatccttattactctttgcgtgatacggttgaagtttgtgaaaga
atcctagatgaatttgaagtgactggtgaaaatcgacatatcattaatggccatacacca
gttaaacgaacaaaaggcgaatcgccaatcaaagcaaatggcacgcttctcgtaattgac
ggcggcttttcaaaatcttatcagacaattactgggattgctggttatacattgttgtac
aactcgtttggtttacaactgaccgcgcataaatctttttctagtaaagaaacagccatt
ttaaataatcaagacattcattccatcaaacaagtcatcgatcgccccttacagcggcta
ttggtgaaagataccactatcggcaaagagctattaaagcaatcgcaagcactccaaaaa
caaatgaaacaaaaccagtag

DBGET integrated database retrieval system