KEGG   Enterococcus faecalis V583: EF1719Help
Entry
EF1719            CDS       T00123                                 

Gene name
pyrB
Definition
(RefSeq) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00240  Pyrimidine metabolism
efa00250  Alanine, aspartate and glutamate metabolism
efa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EF1719 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EF1719 (pyrB)
Enzymes [BR:efa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     EF1719 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace TACI-CRD2
Motif
Other DBs
NCBI-GeneID: 1200611
NCBI-ProteinID: NP_815425
UniProt: Q9L4T8
Position
complement(1669505..1670431)
Genome map
AA seq 308 aa AA seqDB search
MIITSERISLKHLLTAEALTDREVMGLIRRAGEFKQGAKWHPEERQYFATNLFFENSTRT
HKSFEVAEKKLGLEVIEFEASRSSVQKGETLYDTVLTMSAIGVDVAVIRHGKENYYDELI
QSKTIQCSIINGGDGSGQHPTQCLLDLMTIYEEFGGFEGLKVAIVGDITHSRVAKSNMQL
LNRLGAEIYFSGPEEWYDHQFDVYGQYVPLDEIVEKVDVMMLLRVQHERHDGKESFSKEG
YHLEYGLTNERATRLQKHAIIMHPAPVNRDVELADELVESLQSRIVAQMSNGVFMRMAIL
EAILHGKA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgattattacatctgaacgaattagtttaaaacatcttttaactgctgaggctttaacc
gaccgtgaagtcatggggttaatccgtcgcgcaggagaatttaaacagggggcaaaatgg
cacccagaagaacgtcaatattttgcaacaaacttgttttttgaaaatagtactcgaaca
cataaaagttttgaggtagctgagaaaaaattaggcttagaagtgattgagtttgaagca
agtagaagttctgttcaaaaaggagaaacgttatacgacacagtactaacgatgtcggca
attggtgtagatgtagcagtcattcgtcatggtaaagaaaattattacgatgaattgatt
caaagtaaaacgattcaatgttctattattaacggtggggacgggagtggacaacaccct
acacaatgtttattggatctgatgactatttatgaagaatttggtggatttgaaggcttg
aaagtggcgattgtgggagatattacacattctcgcgttgctaaatcaaatatgcagtta
ttaaaccgtttaggcgctgaaatttatttttcaggtccagaagagtggtacgatcatcag
tttgatgtctatggacaatatgtgccgctagatgaaattgttgaaaaagtcgatgtgatg
atgttgcttcgcgtgcagcacgaacgtcatgatggtaaggaaagtttttcaaaagaaggc
tatcatttggaatatggtttaaccaacgaacgggcaactcgtttacagaaacacgcaatt
attatgcatccagcgccagtcaatcgggatgttgaactggcagatgaattagtggaaagt
ctgcaatcaagaatcgtcgcgcaaatgagtaacggagtctttatgcgcatggcaattttg
gaagcaattttacatggaaaggcctag

DBGET integrated database retrieval system