KEGG   Enterococcus faecalis V583: EF1746Help
Entry
EF1746            CDS       T00123                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00040  Pentose and glucuronate interconversions
efa00052  Galactose metabolism
efa00500  Starch and sucrose metabolism
efa00520  Amino sugar and nucleotide sugar metabolism
efa01100  Metabolic pathways
efa01130  Biosynthesis of antibiotics
Module
efa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EF1746 (galU)
   00052 Galactose metabolism
    EF1746 (galU)
   00500 Starch and sucrose metabolism
    EF1746 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    EF1746 (galU)
Enzymes [BR:efa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EF1746 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 1200636
NCBI-ProteinID: NP_815449
UniProt: Q834C2
Position
complement(1693465..1694361)
Genome map
AA seq 298 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALASGIEDILIVTGKAK
RPIEDHFDSNVELENNLKEKNKTDLLKLVEETTDVNLHFIRQSHPKGLGHAVLQAKAFVG
NEPFVVMLGDDLMEDKVPLTKQLMDDYEQTHASTIAVMKVPHEDTSKYGIINPEKEIEKG
LYNVENFVEKPKPEEAPSDLAIIGRYLLTPEIFDVLENQKPGAGNEIQLTDAIDTLNKTQ
RVFAREFKGERYDVGDKFGFMKTSIEYGLTHPEVKDNLREYIINLGAQLAKKEQPKEK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaggcagttattccagcagctgggttaggaacacgtttcttgccggct
accaaagcgatggcaaaagaaatgttaccgattgttgataaaccaacgattcaatttatt
gtagaagaagcactagcttcaggaatcgaagatattttaattgtgacaggcaaagccaaa
cgtccgattgaagatcattttgattcaaatgttgaattagaaaataacttaaaagaaaaa
aataaaaccgatttattgaaattagtcgaagaaacaacggatgttaatttacattttatt
cgtcaatcccatccgaaaggcttaggacacgctgttttacaagcgaaagcatttgttggc
aatgaaccttttgtcgtgatgttaggcgacgatttaatggaagataaagtgccattaacg
aaacaattaatggatgattacgaacaaacacatgcttcgacaattgcggtaatgaaagta
ccccatgaagatacttcaaaatatggtattatcaacccagaaaaagaaatcgaaaaagga
ctatacaatgtcgagaattttgttgaaaaaccaaaacccgaggaagcaccaagtgattta
gcgattatcggccgttatttattaacccctgaaatttttgatgtacttgaaaatcaaaaa
ccaggcgctggtaacgaaattcagttaacagatgcgattgacactttaaataaaacacaa
cgcgtttttgctcgtgagtttaaaggagaacgttacgacgttggcgataaatttgggttt
atgaaaacaagcattgaatatggtttgactcatccagaagtaaaagataatttacgagaa
tacattattaatttaggtgctcaattagcgaaaaaagagcaaccaaaagaaaaataa

DBGET integrated database retrieval system