KEGG   Enterococcus faecalis V583: EF1746Help
Entry
EF1746            CDS       T00123                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
efa  Enterococcus faecalis V583
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EF1746 (galU)
   00052 Galactose metabolism
    EF1746 (galU)
   00500 Starch and sucrose metabolism
    EF1746 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    EF1746 (galU)
Enzymes [BR:efa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EF1746 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1693465..1694361)
Genome map
AA seq 298 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALASGIEDILIVTGKAK
RPIEDHFDSNVELENNLKEKNKTDLLKLVEETTDVNLHFIRQSHPKGLGHAVLQAKAFVG
NEPFVVMLGDDLMEDKVPLTKQLMDDYEQTHASTIAVMKVPHEDTSKYGIINPEKEIEKG
LYNVENFVEKPKPEEAPSDLAIIGRYLLTPEIFDVLENQKPGAGNEIQLTDAIDTLNKTQ
RVFAREFKGERYDVGDKFGFMKTSIEYGLTHPEVKDNLREYIINLGAQLAKKEQPKEK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaggcagttattccagcagctgggttaggaacacgtttcttgccggct
accaaagcgatggcaaaagaaatgttaccgattgttgataaaccaacgattcaatttatt
gtagaagaagcactagcttcaggaatcgaagatattttaattgtgacaggcaaagccaaa
cgtccgattgaagatcattttgattcaaatgttgaattagaaaataacttaaaagaaaaa
aataaaaccgatttattgaaattagtcgaagaaacaacggatgttaatttacattttatt
cgtcaatcccatccgaaaggcttaggacacgctgttttacaagcgaaagcatttgttggc
aatgaaccttttgtcgtgatgttaggcgacgatttaatggaagataaagtgccattaacg
aaacaattaatggatgattacgaacaaacacatgcttcgacaattgcggtaatgaaagta
ccccatgaagatacttcaaaatatggtattatcaacccagaaaaagaaatcgaaaaagga
ctatacaatgtcgagaattttgttgaaaaaccaaaacccgaggaagcaccaagtgattta
gcgattatcggccgttatttattaacccctgaaatttttgatgtacttgaaaatcaaaaa
ccaggcgctggtaacgaaattcagttaacagatgcgattgacactttaaataaaacacaa
cgcgtttttgctcgtgagtttaaaggagaacgttacgacgttggcgataaatttgggttt
atgaaaacaagcattgaatatggtttgactcatccagaagtaaaagataatttacgagaa
tacattattaatttaggtgctcaattagcgaaaaaagagcaaccaaaagaaaaataa

DBGET integrated database retrieval system