KEGG   Enterococcus faecalis V583: EF1826Help
Entry
EF1826            CDS       T00123                                 

Gene name
adhA
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
efa  Enterococcus faecalis V583
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EF1826 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF1826 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    EF1826 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EF1826 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EF1826 (adhA)
   00626 Naphthalene degradation
    EF1826 (adhA)
Enzymes [BR:efa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EF1826 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1776649..1777665)
Genome map
AA seq 338 aa AA seqDB search
MYKAIVAAKGKTTKIVEKESRPLKDNEARLKMEVCGVCHTDLHVKNADFGDVSGCTLGHE
GIGIVTEVGKDVTSLKIGDRASVAWFYEGCGHCEYCTSGRETLCRSVKNAGYTVDGAMAE
ECIVTDGYAVKVPENLASEPASSITCAGVTTYKAIKESGIRPGQWLMISGLGGLGNLALQ
YAKHVFNAKVVAVDVNDNQLAFAKEMGADLLINPVKDPDFAAQLQKEIGGVHAAVVTAVA
KSAFNGAVDAVRAGGTVVAVGLPVETMDLSIPRLVLDGIHVVGSLVGTRQDLREAFQFGA
EGKVVPVCQTRQPEEINAIFEEMEQGKIRGRMVIDFRS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagcaattgtcgcagcaaaaggaaaaacaacaaaaattgttgaaaaagaatcg
cgtccattgaaagataatgaagcgcggttgaaaatggaagtctgtggtgtctgtcatacg
gatttacacgttaagaatgcagattttggcgatgttagcggttgtaccttaggtcacgaa
ggaattgggattgtgacggaggttggaaaagacgttactagtttaaaaattggtgatcgt
gcatctgttgcatggttttatgaaggctgcgggcattgcgaatattgtacttctggtcga
gaaacgctttgtcgttcagtaaaaaatgctggatatacagttgatggtgccatggccgaa
gaatgcatcgtcacagacggttatgcagtgaaagtgccagaaaatttagcatcagagcca
gcttcctctattacttgtgcaggggtaacaacctacaaagcgataaaagaatctgggatt
cgtccaggtcaatggctaatgatttcaggattaggtgggctaggtaatctagctttacaa
tatgccaagcatgtctttaatgcaaaagtagtagctgttgatgtgaatgataatcagtta
gcttttgcgaaagaaatgggtgctgatcttttaattaatccagttaaagatcctgatttt
gctgcacaacttcaaaaagaaattggcggtgtccatgcagcagtagtcactgcggtagct
aaatcagcatttaatggcgcagtcgatgcagtccgtgcgggaggaacggttgtcgccgtt
ggattgcctgttgagacaatggatttatctattccacgtcttgttcttgatggcattcac
gtagtcggatcgttagttggaacccgtcaagatttaagagaagctttccaattcggtgca
gaaggaaaagttgttcctgtttgtcaaacacgtcaaccagaagaaattaatgctattttt
gaagaaatggaacaaggaaaaattcgcgggcgcatggtcattgattttcgcagttaa

DBGET integrated database retrieval system