KEGG   Enterococcus faecalis V583: EF1851Help
Entry
EF1851            CDS       T00123                                 

Definition
glycosyl hydrolase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
efa  Enterococcus faecalis V583
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EF1851
Enzymes [BR:efa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EF1851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1796177..1798012)
Genome map
AA seq 611 aa AA seqDB search
MQTFEIKEEFLVDGKPTKLISGAIHYFRMTPAQWEDSLYNLKALGANTIETYIPWNLHEP
VEGVYDFEGMKDIVAFVSLAQELGLMVILRPSVYICAEWEFGGLPAWLLKEHVRLRSTDP
RFIAKVRTYFSVLLPKLVPLQVTHGGPVIMMQVENEYGSYGMEKEYLRQTKQVMEEFGID
VPLFTSDGAWEEVLDVGTLIEEDVFVTGNFGSHSKENATVMKAFMAKHDKKWPIMCMEYW
DGWFNRWGEPIIKRDGQDLANEVKDMLALGSLNLYMFHGGTNFGFYNGCSARGVLDLPQV
TSYDYDALLTEAGEPTEKYFHVQRAIKEVCPEVWQAEPRRKTFGSLGTFPVQNSVSLLAV
KDQMMTAQETMYPITMEEAESGYGYMLYSVNLKNYHHENKLKVVEASDRLHLFADGSLQT
IQYQENLREEVMIKGTPEKEWIELDVLVENLGRVNYGFKLNGPTQVKGIRGGIMQDIHFH
QGYRQYALTLSADQLKKIDYTAGKNPAQPSFYQAEFTLTDLADTFIDCRSYGKGVVIVNG
INLGRYWQRGPIHSLYCPKEFLKKGTNEIVIFETEGIEINELIFCGQPIVKKLLTNDFSE
IGSNIHNHIDS
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgtttgagataaaagaagaatttttggtagatggaaaaccaactaaattgatt
agtggcgcaatccattattttcgcatgacaccggcacaatgggaagatagtttatacaat
ttgaaagcactgggtgcgaataccatagagacttatattccttggaatctgcatgagcca
gtggaaggcgtctatgactttgagggcatgaaagacatcgttgcttttgtgtcattggcg
caagaacttggcttgatggtgattttgcggccatctgtctatatttgtgcggaatgggaa
ttcggcgggctacctgcttggttgctgaaagagcacgtgcgattgcgttcaactgatcca
cgatttattgcaaaagtccgtacttatttcagtgtgcttttaccaaaattagttcctttg
caagtgacacatggcggaccagtcatcatgatgcaagtcgaaaatgaatatggttcttat
ggcatggaaaaagagtatttgcggcaaacaaaacaggtgatggaagaatttggcatcgat
gttccgttatttacgtcagatggtgcttgggaagaagtgctggatgtgggcacactgatt
gaagaggatgttttcgtgacaggaaatttcggcagtcattccaaagagaacgctacagtg
atgaaagcatttatggcaaaacacgacaaaaagtggccgattatgtgcatggaatactgg
gacggttggttcaatcgttggggagaaccgattatcaagcgtgatggccaagatttagct
aatgaagtcaaggatatgctagccttaggttcattgaatctctatatgttccatggcgga
accaattttggtttttataatggttgttctgctcgtggtgtgttggatttgccacaagtg
actagctatgactacgatgcgctattgacggaagctggcgagccgactgagaaatacttc
catgtacaaagagccattaaagaagtatgtcctgaagtgtggcaagccgagccccgcagg
aaaacatttggttctttaggaacattccctgtgcaaaacagcgtctcactgttggcggta
aaagaccagatgatgacggcccaagaaacgatgtatccaataacgatggaagaagcagaa
tctggttatgggtatatgctttattcagtaaacttaaaaaattatcatcacgaaaataag
ctcaaagttgtggaggccagtgaccgattgcatctttttgcagacggtagcctgcagaca
attcaatatcaagaaaaccttagggaagaagtgatgatcaagggtacgccagagaaagaa
tggattgaactagatgttttagtagagaacttaggccgagtgaactatggctttaaattg
aatgggccgacacaagtgaaaggcattcgtgggggaatcatgcaagacatccattttcat
caaggctatcggcaatatgcattgacattgtcagcagatcaactcaaaaaaatcgattat
actgccggtaaaaatccggcccagccttctttttatcaagctgaattcacattgactgac
ctcgcggatacatttatcgattgccgcagctatggcaaaggggtggtcatcgtcaacggt
atcaatttaggtcgttactggcaaagaggaccgattcattccttgtattgtccgaaagag
tttttgaagaaaggcacaaatgagatcgtgatttttgaaacggaagggatagaaattaat
gagctcatcttttgtggacaaccgatagtcaagaaacttttgactaatgatttttctgaa
ataggttcaaatatccataaccatatagacagctag

DBGET integrated database retrieval system