KEGG   Enterococcus faecalis V583: EF1922Help
Entry
EF1922            CDS       T00123                                 

Definition
LacI family transcriptional regulator
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
efa  Enterococcus faecalis V583
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EF1922
Enzymes [BR:efa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EF1922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1863156..1865066
Genome map
AA seq 636 aa AA seqDB search
MNIKDIAKLAGVSASTVSKIINNKDQTISKETRERVLKIVRDYNYTPYSANLVTNSTTKT
FVLLLNSHETFEAWVTSFIDKAQENGYNCLILNSHGSLEQELKNITSPTLKQASGIIWDP
INENSKQYAKFIEELTIPYYFVNHSTNELPSLAGLYEEASYVLTQELLQNNHKKISYFVT
NPKYKEAIIAGYKKALFDVNLPFSKENILTTIPADFSNQLITDGITGILTDDYTQAVFLE
QLLKQSGLRTPDNYSLLAIKRKIDRSFLPDHISSVLLDTETFGSKLALLLLNKRKEKTAL
INEAEKLVLDHKNTLGMSSVNPHSKMIVVGSLNVDNYLYSTNLPHNGKTNFLSSYAKFPG
GKGLNQAVGLTKLGHQATLIGCLGSDTDANYLYKELEKYHVTTDGITRIQDTETGQAYIY
VETSGDSMISILPGANTALTPKKIAQQKHLFMDASFCLIQTEIPLSAVEKACEIAQHSGV
PIILKPAAIHHIPVNILEKVDFFIPNEDELLELQPDTGTLEEKAAYFLEMGVKNVIVTLG
KKGVLLKTPQVCHYFPATENIAVDSTGASDSFISALASYLSKGYPTEAAIQIAIQAAGFS
VSKEGVIDSLVDHVTLENYLIKKEPALFAHRNTCID
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaagatattgcaaaattagctggcgtttccgcttcaactgtatccaaaatt
ataaataataaagatcaaactattagtaaagaaacccgtgagcgtgtcttaaaaatcgtt
cgagattacaactacacaccttactcagcaaatctcgtcacaaatagtactacaaaaacc
ttcgtgttattattaaatagccatgaaacttttgaggcttgggttacgagctttattgat
aaagctcaagaaaatggctataactgcttgattttaaatagtcacggtagtttagaacaa
gaactgaaaaatattacctcgccaactttaaaacaagccagtggcattatttgggaccca
atcaatgaaaacagtaaacaatacgcgaaatttatagaagaattaacgattccttactat
ttcgtcaatcactcaactaacgaattaccttctctagcggggctttatgaagaagctagt
tatgttttaacccaagaattattacagaataaccataaaaaaattagttatttcgtcact
aacccaaaatataaagaagcaattattgcaggctataaaaaagccttgtttgatgtcaat
ttaccctttagtaaagaaaatattttaactactatccctgctgatttcagtaatcagctt
atcacagatgggattacgggtatccttactgatgactatacccaggctgtttttttggaa
cagcttttaaagcagagcggtttgcgaacccccgataattactctttactcgcaattaag
cgaaaaattgatcgttcatttttacctgatcatatttcttccgtcttattagatacagag
acgtttggtagcaagttagccttattattgcttaacaaacgcaaagaaaaaacagccttg
attaatgaggctgaaaaattggtgctagatcacaaaaatacattaggcatgtctagtgtt
aatccacatagcaaaatgattgtagtgggtagtttaaacgttgataattatctgtattca
acaaatttaccacataacggcaaaacaaattttttgtctagctatgctaaattccccggc
ggaaaaggattaaatcaagctgttggcttaaccaaactgggccatcaggccaccttaatt
ggttgtttaggctcagacacagatgcgaattacttatataaagaattagaaaaataccac
gttacgacagatggtatcacacgtattcaagatactgagactggtcaagcttatatttat
gttgagacaagcggcgactccatgatttcaatcttacctggtgcaaacacagcgcttacg
cctaaaaaaatcgcacagcaaaaacacctatttatggatgccagtttttgtctcattcaa
acagaaattcctttgtctgctgtagagaaagcttgtgaaatcgcccaacattcaggggta
ccgattattttaaaaccagctgctattcatcatattccagtgaatatactagaaaaggtt
gattttttcattcccaatgaagatgaattattggaacttcaaccagatactggtacatta
gaagagaaagcggcgtacttcttagaaatgggcgtaaaaaatgtcattgttactttagga
aaaaaaggcgtgttattaaaaacaccccaagtgtgccactatttccctgcaacagaaaat
atagctgtggatagcactggtgccagtgacagctttatcagcgcgctcgcctcctatctt
tcgaaaggttatccgactgaagcagccattcaaatagcaattcaggctgcaggattttca
gtttctaaagaaggggtgattgattctttagttgatcacgtcactttggaaaattatttg
ataaaaaaagaacccgctctttttgctcatcgtaacacctgtatcgactga

DBGET integrated database retrieval system