KEGG   Enterococcus faecalis V583: EF1962Help
Entry
EF1962            CDS       T00123                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00010  Glycolysis / Gluconeogenesis
efa00051  Fructose and mannose metabolism
efa00562  Inositol phosphate metabolism
efa01100  Metabolic pathways
efa01110  Biosynthesis of secondary metabolites
efa01120  Microbial metabolism in diverse environments
efa01130  Biosynthesis of antibiotics
efa01200  Carbon metabolism
efa01230  Biosynthesis of amino acids
Module
efa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
efa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF1962 (tpiA)
   00051 Fructose and mannose metabolism
    EF1962 (tpiA)
   00562 Inositol phosphate metabolism
    EF1962 (tpiA)
Enzymes [BR:efa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EF1962 (tpiA)
Exosome [BR:efa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EF1962 (tpiA)
  Exosomal proteins of bladder cancer cells
   EF1962 (tpiA)
  Exosomal proteins of melanoma cells
   EF1962 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1200837
NCBI-ProteinID: NP_815638
UniProt: Q833J0
Position
complement(1899386..1900141)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAQSFAEAVKNAVPSNDVVDAVIGSPALFLAPLAWNLKDSEVK
LAAQNCYWENAGAFTGENSPAAIADLGVDYVIIGHSERREYFHETDEDINKKAKAIFANG
MTPIFCCGETLETYEAGKTAEWIEGQITKGLVGLSNEQVASMVIAYEPIWAIGTGKSADA
NIADEICGVVRSTVEKLYGKEVSEAVRIQYGGSVKPENIAEYMAKENVDGALVGGASLEA
DSFLALLDAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccaattatcgctggtaactggaaaatgaacaaaactttaagcgaagcacaa
agctttgcagaagcagtaaaaaatgctgttccatcaaacgacgttgttgacgctgtgatt
ggatctccagcattattcttagctcctttagcttggaacctaaaagattctgaagtgaaa
ttagctgcacaaaactgctactgggaaaacgctggtgccttcactggtgaaaactcacca
gctgcaattgcagatttaggtgtagactatgtgattatcggacactctgaacgtcgcgaa
tatttccacgaaacagatgaagatatcaataaaaaagccaaagcaatctttgcaaatggt
atgacaccaatcttctgttgtggtgaaactttagaaacgtatgaagctggtaaaacagcg
gaatggatcgaaggtcaaatcactaaaggcttagttggtttatcaaacgaacaagttgct
tcaatggttatcgcttacgaaccaatttgggcaatcggaactggtaaatctgcagatgct
aatattgcagatgaaatctgtggtgttgttcgttcaacagttgaaaaattatacggcaaa
gaagtttctgaagctgttcgtattcaatacggtggttctgttaaaccagaaaacatcgct
gaatatatggcaaaagaaaacgttgacggtgctttagtcggcggcgcaagcttagaagca
gattcattcctagctttattagatgctgtaaaataa

DBGET integrated database retrieval system