KEGG   Enterococcus faecalis V583: EF1962Help
Entry
EF1962            CDS       T00123                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
efa  Enterococcus faecalis V583
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EF1962 (tpiA)
   01230 Biosynthesis of amino acids
    EF1962 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF1962 (tpiA)
   00051 Fructose and mannose metabolism
    EF1962 (tpiA)
   00562 Inositol phosphate metabolism
    EF1962 (tpiA)
Enzymes [BR:efa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EF1962 (tpiA)
Exosome [BR:efa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EF1962 (tpiA)
  Exosomal proteins of bladder cancer cells
   EF1962 (tpiA)
  Exosomal proteins of melanoma cells
   EF1962 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1899386..1900141)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAQSFAEAVKNAVPSNDVVDAVIGSPALFLAPLAWNLKDSEVK
LAAQNCYWENAGAFTGENSPAAIADLGVDYVIIGHSERREYFHETDEDINKKAKAIFANG
MTPIFCCGETLETYEAGKTAEWIEGQITKGLVGLSNEQVASMVIAYEPIWAIGTGKSADA
NIADEICGVVRSTVEKLYGKEVSEAVRIQYGGSVKPENIAEYMAKENVDGALVGGASLEA
DSFLALLDAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccaattatcgctggtaactggaaaatgaacaaaactttaagcgaagcacaa
agctttgcagaagcagtaaaaaatgctgttccatcaaacgacgttgttgacgctgtgatt
ggatctccagcattattcttagctcctttagcttggaacctaaaagattctgaagtgaaa
ttagctgcacaaaactgctactgggaaaacgctggtgccttcactggtgaaaactcacca
gctgcaattgcagatttaggtgtagactatgtgattatcggacactctgaacgtcgcgaa
tatttccacgaaacagatgaagatatcaataaaaaagccaaagcaatctttgcaaatggt
atgacaccaatcttctgttgtggtgaaactttagaaacgtatgaagctggtaaaacagcg
gaatggatcgaaggtcaaatcactaaaggcttagttggtttatcaaacgaacaagttgct
tcaatggttatcgcttacgaaccaatttgggcaatcggaactggtaaatctgcagatgct
aatattgcagatgaaatctgtggtgttgttcgttcaacagttgaaaaattatacggcaaa
gaagtttctgaagctgttcgtattcaatacggtggttctgttaaaccagaaaacatcgct
gaatatatggcaaaagaaaacgttgacggtgctttagtcggcggcgcaagcttagaagca
gattcattcctagctttattagatgctgtaaaataa

DBGET integrated database retrieval system