KEGG   Enterococcus faecalis V583: EF2585Help
Entry
EF2585            CDS       T00123                                 

Definition
(RefSeq) mur ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00300  Lysine biosynthesis
efa00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    EF2585
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EF2585
Enzymes [BR:efa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     EF2585
Peptidoglycan biosynthesis and degradation proteins [BR:efa01011]
 Precursor biosynthesis
  Amino acid ligase
   EF2585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M BALF1 POTRA_3 TF_Zn_Ribbon DUF1652 OrfB_Zn_ribbon A2L_zn_ribbon zf-TFIIB Zn_Tnp_IS1595 zinc_ribbon_10
Motif
Other DBs
NCBI-GeneID: 1201446
NCBI-ProteinID: NP_816226
UniProt: Q831C6
Position
2502660..2504012
Genome map
AA seq 450 aa AA seqDB search
MGIRSHLAIAAGKTSQWVLQTFFKGGSSYPGKLALKIDPKILDTLAKDYEIVVVTGTNGK
TLTTALTVNILRQEFDEVLTNPTGANMEQGIVSTFLNAKAKKGQKKFAVLEIDEASLSRV
TKYIQPKLFVFTNIFRDQMDRYGEIYTTYRLIMEGAAAAPEATILCNGDSPIFNSKETVN
PRKYYGFNHLPPKEQLAHYNTDGVLCPKCNHILHYKMITYANLGDYYCPNCGFKRPELDV
QLTEMVRMDNTSADFVIDGEEYGIAVGGMYNVYNALAATAVAEYYQVAPDKIRAGLAYDE
KVFGRQETIKVGDKECTLVLVKNPVGLNQVIDMMGLAPYSFSLVSLLNANYADGIDVSWI
WDGNHEAFADMDIPKVIAGGDRHEDMALRLKVAGIPEEKLLEIADLEQVISEIKTLPTDH
VYILATYTAVLQLRKSLTAQGYIQGGMNGV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggggattcgaagtcatttagcaattgctgcaggaaaaacttcgcaatgggttttacaa
acattttttaaaggcggcagtagctacccagggaaattagccctaaaaatcgatcctaaa
attttagatacattggcaaaagactatgaaattgtcgtagtcactggaacgaacggcaaa
acattgacaactgctttaactgttaacattttacgccaagaatttgatgaggtattaaca
aatccaactggtgctaacatggagcaaggaattgtctctacttttttaaatgccaaggcg
aaaaaaggacaaaagaaatttgcggtgttagaaattgatgaagcaagtttaagccgtgtc
actaaatatattcaaccaaaattatttgtttttacgaatattttccgcgaccaaatggat
cgctatggtgaaatttatacgacgtatcgcttaattatggaaggcgccgctgctgctcct
gaagcaactattttatgcaatggtgattcgccaatttttaattcaaaagaaactgtaaat
cctcgcaaatactatggatttaatcatttaccaccgaaagagcaattggctcattacaat
acagatggggttttatgtccaaaatgtaatcatattcttcattataaaatgattacgtat
gctaatttaggtgattactattgcccaaattgtggcttcaaacgccctgaattggatgtg
cagttaacggaaatggtccggatggataatacatctgctgattttgtgattgatggcgaa
gaatacggcattgctgttggtgggatgtataatgtttataatgcgctagcggccacagcg
gtagcagaatattatcaggtggcaccagataaaatccgagcaggcttagcttatgatgaa
aaagtttttgggcgtcaagaaaccattaaagttggcgataaagaatgtacgttagtttta
gtaaaaaatcccgttggtttaaatcaggtcattgatatgatgggcttagccccttactct
ttctcgctggtttcattattaaatgctaattatgcagatggaattgatgtcagttggatt
tgggatggtaatcatgaagcctttgctgatatggacattccaaaagtaattgctggcggt
gatcgccatgaagatatggccttgcgtttaaaagttgcgggtattcctgaagaaaaatta
ctagaaattgctgatttagagcaagtaatttcagaaattaaaacgttgccgacagatcat
gtctatattttggcaacctatactgctgttttgcaattaagaaaatcattaacagcccaa
gggtatattcaagggggaatgaatggtgtctaa

DBGET integrated database retrieval system