KEGG   Enterococcus faecalis V583: EF2595Help
Entry
EF2595            CDS       T00123                                 

Gene name
gmk-1
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00230  Purine metabolism
efa01100  Metabolic pathways
Module
efa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EF2595 (gmk-1)
Enzymes [BR:efa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     EF2595 (gmk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_22 PPK2 AAA_23 AAA_16 AAA_24 Alpha_L_fucos RsgA_GTPase Gtr1_RagA NB-ARC AAA_28
Motif
Other DBs
NCBI-GeneID: 1201456
NCBI-ProteinID: NP_816236
UniProt: Q831B6
Position
complement(2514163..2514732)
Genome map
AA seq 189 aa AA seqDB search
MIKQLQHPFFVIMGPSGSGKTAITSKVFPKNYKVISHTTRKKRLDEVDGVDYYFETKASF
QALIETNQLVEYDFYHGNYYGVGVAAIVETTKEHPAYNALTFPGFQAVFERFGESVIPVF
FDVSKENIYQRLKQRESDPKIIEERLNLYDQEILIKNQLEQYPNYQRIDANGPIKEVAGL
LQECIKHYY
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcaattacaacatccattttttgttattatgggtccgagtggttctggcaag
accgcaattacaagtaaggtttttccgaaaaactataaagttatctcgcatactacgagg
aaaaaacgattggatgaagtggatggcgtggattactattttgaaacaaaagcaagtttt
caagccttgattgaaaccaatcagttagtggagtatgatttttaccatggaaactattac
ggtgtcggtgtagctgccatcgttgaaacaacgaaagagcatccagcctataatgcgtta
acttttccaggctttcaagcggtctttgagcgtttcggcgagtccgtcattccagttttt
tttgacgtttcaaaagaaaatatttatcaacgtttaaaacaacgagaatctgatcctaaa
attattgaagaacgtttaaacctttatgatcaagaaattcttatcaaaaaccaattggaa
caatatcctaattatcaacgaatagatgccaatggacctataaaagaggtcgctggcttg
ttacaagaatgcatcaaacactattattaa

DBGET integrated database retrieval system