KEGG   Enterococcus faecalis V583: EF2597Help
Entry
EF2597            CDS       T00123                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efa  Enterococcus faecalis V583
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF2597
Enzymes [BR:efa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EF2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2514914..2516359)
Genome map
AA seq 481 aa AA seqDB search
MTTTTKFPKGFLWGGATAANQLEGAYLADGKGLSVADAMPGGKQRFAILGDEAFDWTIDE
TKYRYPNHTGIDHYDRFKEDIALFAKMGFKCYRFSIAWSRIFPQGDETQPNEAGLKFYDA
VIDECLSYNIEPVITISHYEMPLHLAKEYGGWKNRQLVDFYERFAETVLTRYHQKVNYWM
TFNEINSAFHFPALSQGLVKSNGANDYQNIFQAWHNQFVASSKAVKIGHELNPELQIGCM
IIYATTYGIDSNPVNQVATMIENQEFNYYCTDVQVRGEYPAYAERMYQKYAVKDLVIEEG
DLELLKEYPVDYIGFSYYMSTAVDVTGTTNDTANGNLLGGVKNPFLEASEWGWQIDPEGL
RIALNELYNRYQKPLFIVENGLGAIDKVDENFYVADDYRIDYLRRHIEAMAEAVADGVDL
MGYTPWGCIDLVSASTGEMSKRYGFIYVDLDDEGNGTKNRYEKKSFNWYKQVIETNGQNL
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacgacaaaatttccaaaaggatttttatggggcggtgcgaccgcagccaat
caattagaaggggcttacttagccgatggtaaagggttatctgtggcagatgcgatgccg
ggaggaaaacaacgtttcgctattttaggagatgaagcgtttgattggacgattgacgaa
acgaaatatcgctaccctaatcatacaggaattgatcactatgatcgctttaaagaggac
attgcgttgtttgctaaaatgggcttcaaatgttatcgcttttcaattgcgtggtcgcgt
atttttccacaaggagatgaaacacaaccgaatgaagccggcttgaaattttatgatgcg
gttatcgatgaatgtttaagctataacattgaaccagtaattacgatttctcattatgaa
atgccactgcatttagcgaaagaatacggcgggtggaaaaatcgtcaattagttgacttt
tatgaacgttttgcggaaactgttttaacacgttaccaccaaaaagttaactattggatg
acattcaatgaaattaattcagcttttcatttcccagcgcttagtcaaggattggtaaaa
agcaatggagccaatgattatcaaaacattttccaagcatggcataatcaatttgttgca
agtagtaaagctgtaaaaattggccatgaattaaatccagaattacaaattggatgtatg
attatttatgccacaacgtatggcattgattcgaatccagtcaatcaagttgctacaatg
attgaaaaccaagagtttaattattattgtacagatgttcaagttcgtggtgaatatcca
gcatacgcagaacgcatgtatcaaaaatatgctgtgaaagacttagttattgaagaagga
gatttagaattattaaaagaatacccagtggattacattggctttagttattatatgtcg
actgctgtcgatgttactggtactaccaacgatacagcaaatgggaatcttttaggcggc
gttaaaaatcccttcttagaagcaagtgaatggggttggcaaattgatcccgaaggctta
cgaatcgccctaaatgaattatataatcgttatcaaaaacctttatttattgtggaaaac
ggcttaggtgcaattgataaagtagacgaaaatttctatgtggcagacgactatcggatt
gattatttacgtcgtcatattgaagcaatggcagaagcagttgcagacggcgtcgattta
atgggctatacgccgtggggctgtatcgatttagtcagtgcttccacaggtgaaatgagt
aaacggtatgggtttatttacgttgatttagacgatgaaggaaatggtactaaaaaccgt
tatgaaaaaaaatcgtttaattggtacaaacaagttattgaaactaatggacaaaactta
gactag

DBGET integrated database retrieval system