KEGG   Enterococcus faecalis V583: EF2618Help
Entry
EF2618            CDS       T00123                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
efa  Enterococcus faecalis V583
Brite
Enzymes [BR:efa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     EF2618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2533707..2534471)
Genome map
AA seq 254 aa AA seqDB search
MAKKINLPKPLFSEKGKRAVLLLHAYSGSSNDVRMLSRRLEKENYTVYSPNFSGHGTLVP
EDILDQTTEQWWQDTQEAVAFLRERGYQEIAIFGLSMGGIFSMHALTEQLTGLIGGGFFC
SPIYPVENKVPENFVLYAENVMKIAEVPAEEQQSRLQSIEQRVKQQLGAIETIASQTADK
LNKIHAPLFLAQAGKDEMIEPMGVYQTAQALTQARVTLQWYPNSGHVITVSGEHKQLEQD
VVQFLATLPWNEEK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaaaaaatcaatttaccgaagccgttattttcagaaaaaggaaaacgggcggtc
cttttattacacgcttattctggcagcagtaatgatgtacggatgttaagcagacgttta
gaaaaagaaaattatactgtctattcgcctaatttttcaggacatggcacgctagttcct
gaagatattttagatcaaacaacggaacaatggtggcaagatacacaagaagcagtcgct
tttttgagagaaagaggctaccaagaaattgccatttttggtttatcaatgggcgggatt
ttcagtatgcatgcattaacggaacaattaacaggattaattggtggtggatttttctgt
tcaccgatctaccctgtcgaaaataaagtcccagaaaattttgtattatacgcagaaaac
gtgatgaaaatcgcagaagttcctgcagaggaacaacaaagccggttgcaatcgattgag
caacgagtcaaacaacaattaggagcgattgaaacgattgctagtcagacggctgacaaa
ctaaacaaaatccacgcacctcttttcttagcgcaagctggcaaagatgaaatgattgag
ccaatgggcgtctatcaaacggcccaagcactaacacaagcacgtgtgaccttacaatgg
tacccaaacagcggacatgtcattacggtgagtggagaacacaaacaattagagcaagat
gtggtgcaatttttagcaacactaccttggaatgaggagaaataa

DBGET integrated database retrieval system