KEGG   Enterococcus faecalis V583: EF2663Help
Entry
EF2663            CDS       T00123                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
efa  Enterococcus faecalis V583
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EF2663
Enzymes [BR:efa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EF2663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2574013..2576610)
Genome map
AA seq 865 aa AA seqDB search
MVTLFGEDEEKAFIVGTVQAIFFENPSNFYKVVLVNVTDTNTDYLEKEIVVTGSFGQVQE
EEPYRFFGHFVDHPRYGRQFQVDSYQQERPTSASGVVNYLSSDKFPGIGKRTAEKIVEVL
GESAIDRIIDDPSVLEEVTVLNEKKRQVIVETIRLNHGMEQVIVGLNRYGFGSQLAFSIY
QTYQEETLSVIQENPYQLVEDIEGVGFKRADNIAEQIGIQADSAVRIRAAILHEVFEHSI
RSGNTYVQADVLLEEAIRTLEASRPVEISPDQVANEIITLVEHGKIQQEETKLFENSLYF
SEWGIGTSIQRLLSRKKEIHYEEEEVQKNIRMIEKRLNIQYGDSQQAAIEEAIKSPLFIL
TGGPGTGKTTVINGIVSLFAELNGLSLDLKDYTQEMFPILLAAPTGRAAKRMNETTGLPA
STIHRLLGLTGREKNPSLTAKELEGGLLIVDEMSMVDTWLANTLLKAIPTNMQVIFVGDK
DQLPSVGPGQVLHDLLQINEIPKCELNEIYRQGDGSSIIPLAHEIKEGKLPADFQKNQKD
RSFFASDIGHIEEYIRQIVTKAKAKGFTPQDIQVLAPMYRGAAGIDALNKMMQEIFNPND
GKKKEVKWNDTVYRIGDKVLQLVNTPELNVFNGDMGEIVGITLAKDSEDKVDELVLQFDN
NEVTYKRNEWNKITLSYCCSIHKAQGSEFRMVLLPMVHQYSRMLQRNLLYTAVTRSKELL
ILLGEVSAFETCVKNESASRMTMLKERIVNAEQMTLTTRTQLEAYEEGLTADHPFTETET
KAVFYETEQQSTKADQIKETDEQLVDTTVQEVSLFADEGEESTSPAEPQKEEQLPENPVL
SIQEIQENKINPMIGMAGTTPYQFM
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
gtggtaacactttttggtgaggacgaagaaaaagcctttattgttggaactgtacaagca
atcttttttgaaaatcccagtaatttttataaagtcgttcttgtaaatgtgaccgataca
aatacagattatttagaaaaagaaattgtagtaactggaagttttggccaagttcaagaa
gaggaaccctatcgtttctttggtcattttgtggaccatcctcgttatggcagacagttt
caggtggatagttatcagcaagaaagaccgacttcggctagtggggtggttaactattta
tcaagtgacaaatttcctggcattggtaaacgaaccgctgaaaaaattgttgaagtatta
ggggaaagtgcgattgaccgaattattgatgatcctagtgttttggaagaagttactgtt
ttaaatgaaaaaaaacgtcaagtaatcgtcgaaacaattcgcttgaatcacgggatggag
caagtgattgtgggactaaatcgatacggctttggtagtcagttagctttttcaatttat
caaacctatcaagaagaaaccctttctgtgattcaagaaaatccctatcagttagttgaa
gatattgagggagtcggatttaaacgagcggacaatattgctgaacaaatcggcattcag
gcggattctgctgttcgaattcgagcggcgattttacatgaagtgtttgaacactctatt
cgttcaggcaatacgtatgttcaagcagatgttttgttagaagaagcgattcggaccttg
gaagcaagtcgcccagtggaaatctcacctgatcaagtggccaatgaaatcattacgtta
gtcgaacatggaaaaatccaacaagaagagactaaactttttgagaacagtctctatttt
tctgaatggggcattggtacttcgattcaacgtttactttctcgtaaaaaagaaattcat
tatgaggaagaagaagtccaaaaaaatatccgaatgattgagaaacgtttaaatattcag
tatggcgactcgcaacaagcagcgattgaagaagcgattaaatcgccgttatttatttta
actggagggcccggaacagggaaaacaactgttatcaatgggattgtctcgttgtttgcg
gaactaaatggcctttcattagatctcaaagactatacgcaggagatgtttccaatcttg
ctagcggcgccaactgggcgagcagcgaaacgtatgaacgaaacgacaggtttacctgca
agtaccatccaccgtttgttaggcttgacaggtcgtgaaaaaaatccgagtttaaccgcc
aaagaattagaaggtggtttgctaattgtagatgaaatgtccatggtggatacttggtta
gccaatacgttattaaaagctattccgacaaacatgcaagtgatttttgttggtgataag
gatcagctaccgtctgtcggtccaggtcaagtcttacatgacttattgcaaattaacgaa
attcccaaatgtgagctaaacgaaatttatcgtcaaggagacggttcaagtattattcct
cttgcccatgaaattaaagaaggaaagttgcctgctgattttcaaaaaaatcaaaaggat
cgctcgttctttgcaagtgatattggtcatattgaagaatacattcgacaaatcgtcaca
aaggcaaaagcaaaagggtttacgccacaagatatccaagttttagcgccaatgtatcgt
ggcgcagccggcattgatgccttgaataagatgatgcaagaaatcttcaatccaaatgat
ggtaagaaaaaagaagtcaaatggaatgacaccgtctatcggatcggggacaaagttttg
caactagtcaatacgccagaattaaatgtgttcaatggagatatgggagaaatcgtcgga
attactttagccaaagactcagaggacaaagtggacgagttggttttacagtttgataat
aatgaagtaacgtataaaagaaatgaatggaataaaattacgctatcgtattgttgttcg
attcataaagcgcaaggtagtgaattccgcatggtgttactgccaatggttcatcagtat
agccgaatgctgcaacgaaatttgctgtatacagcagtgacacgtagtaaagaattatta
attctactaggtgaggtttctgcttttgaaacatgtgtcaaaaacgaatcggctagtcgc
atgacgatgctaaaagaacgaatcgtgaacgcagaacaaatgaccttaacgactagaact
cagttagaagcctatgaagaaggtttaacggcagaccatccatttactgaaacggaaaca
aaagctgtcttttatgaaactgaacagcaatcaacgaaagccgatcagatcaaagaaaca
gacgagcaattagttgacacaacggtacaagaggtttcactatttgctgatgaaggggaa
gagtcaacctcaccagctgaaccacagaaagaagaacaattacctgaaaatcctgtattg
tcaattcaagaaattcaagaaaataaaattaatccaatgattggtatggctggaaccact
ccatatcagtttatgtga

DBGET integrated database retrieval system