KEGG   Enterococcus faecalis V583: EF2709Help
Entry
EF2709            CDS       T00123                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
efa  Enterococcus faecalis V583
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:efa00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:efa00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2621588..2624665)
Genome map
AA seq 1025 aa AA seqDB search
MKTWENYKVDSINRLPGRAHFSSFPSKETALLNENKYTQAYKNLNGCWHFLFLEAPEYSP
ENFFATDFDTSQMDQITVPGNWQVQGYGKMHYSDLWYNFPINPPYVPTENPTGIYKRTFA
IDETFHDKKIILRFCGVDSAYHVWVNGHEVGYSKGARNEAEFDITPYAKIGETNDLTVRV
YQWSDGTYLEDQDMWWLSGIFRDVELLGVPENGLEDFFIISDLDDSYQNGHLAITGKFWQ
DKGQQVQLELMDQQGKTVLKETVAGNQGTVEFSASLPSVTAWSAEKPYLYQLFITVFSEG
EVVEVIPQKVGFRNIHVSGETFLVNGVAIKLKGMNRHDYNPKNGRVVSREEIEKDIRLMK
QFNINAIRTSHYPASAYFYDLCDEYGMYVIDETDLECHGFELTGEYDWISNDPEWETAYV
SRMVRMIQRDKNHPSILFWSLGNESAFGHNFIEMARIAKEMDPTRLVHYEGDFEAEVTDV
YSTMYTWLEHPTRELLMNTIIENSKKPHILCEYCHAMGNGPGNLKEYQELFYAHDKLQGG
FIWEWFDHGIESVTDNGEVYYRYGGDFGDDPSNKDFCIDGMLMPDRTPSPSLYEYKKVIE
PITTSAIDVLSGEFSLLSRFDFENLAIFKLVYTITEDQTVIQSGTVAVPAIAARAEGRLH
LPYHLDFPKKAGAAYYLTLSYQLKETTAYASAGHELATAQFELPIATPGIEITPVGSLMA
KEIGPHLYIEGPNFSINFDKVKGALTNVTRDGKKLLHKGPKFTFWRAPISNDMEIIDEMK
KKYFLHLEHEIVRSFEWKKVDDFIQVIVKTINGTTNSAWHYQCTYQYLIAPNGEIFFDLK
GSPAGKIENAPDMLPRLGVTLHLDKSLSEVKYFGKGPRENYVDSQEAGLLGVYDATVAEM
FTNYVVPQANGNHMATKWSAFTDDRGQGVVATAADSYNFSVSYFEEQALDVAKHTNELQE
SEYVVLNIDYKQNALGSYSCGQWQLEKYRTTFEEFQLAFRLTPFNNKEIQAADVAHERVK
RPTIS
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttgggaaaattataaagtagatagtattaatcggttgcctggacgagcacac
ttttcgagctttccttcgaaagaaacagcgttattaaatgaaaataaatatacacaagca
tacaaaaatttaaacggatgctggcattttctctttttagaagcgccagaatacagccca
gaaaacttttttgcgacggactttgatacaagccaaatggatcaaatcactgttcctgga
aattggcaagtccaaggatatggcaaaatgcattactctgatttatggtacaattttccc
attaatccgccgtatgtaccaacggaaaacccaacaggtatttacaaacggacatttgct
atagatgaaacatttcacgataaaaaaatcattttacgtttttgtggcgtagattcagct
tatcatgtttgggtgaacggccatgaagttggctacagtaaaggtgcacgaaatgaagca
gaatttgacattacgccttacgctaaaattggtgaaacaaatgatttaacggtgcgagtc
tatcaatggtcagatggtacgtatttagaggatcaagatatgtggtggttaagtggtatt
tttcgtgatgttgaattactcggtgtaccagaaaatgggctggaagatttctttattatt
tccgatttagatgattcgtatcaaaatgggcacttggcaattacgggtaaattttggcaa
gacaaaggacaacaagttcaattggagttgatggatcagcagggaaaaacggttcttaaa
gagactgtcgcaggaaatcaaggtacggttgaattttcagcaagtttgccgtctgtcact
gcttggtcagctgaaaaaccatacttgtatcaactatttatcactgttttttctgaaggg
gaagtcgtcgaagttattccgcaaaaagttggtttcagaaatattcatgtatctggtgag
actttcttagtcaatggtgtggccattaaactaaaaggaatgaatcgtcatgattataat
ccgaaaaatggtcgagtggttagtcgtgaagaaattgaaaaagatattcgtttaatgaaa
caatttaatattaatgccattcgaaccagtcattatccagcatctgcttatttctatgat
ttatgcgatgaatatggaatgtatgtgattgatgaaactgatttggaatgtcacggcttt
gaattaaccggagaatatgattggattagcaacgatccagaatgggaaacggcttatgtt
tctcggatggtacggatgattcaacgggataaaaatcatccatcaattctcttttggtcg
ttagggaatgaatctgcgtttggtcataactttattgaaatggcccgtattgcaaaagaa
atggatccaacacgtttggttcattatgaaggtgattttgaggcagaggtcacggatgtc
tattctacaatgtatacgtggttggaacacccaactagagaattactgatgaatacgatt
attgaaaattcaaaaaaaccgcatattttatgtgaatattgtcatgcgatgggtaatggc
cctgggaatttaaaagaataccaagagctattttatgctcatgataaattacaaggtggc
tttatttgggaatggtttgaccatggcattgaatctgtaacagataacggtgaagtttat
tatcgttatggcggcgatttcggcgatgatccaagtaacaaagatttttgtattgatggg
atgttgatgcctgaccgtacgccatctcctagcttgtatgaatacaaaaaagtcattgaa
cccattacaactagcgctattgacgttctgtcaggtgaattctcattattgagtcggttt
gactttgaaaacttggctatctttaagctggtttatacaattactgaagatcaaacagtg
attcaatcagggacagtagcagtgccagcaattgctgctagagcagaaggaagactgcac
ttaccttatcatttagattttcctaaaaaggcaggagccgcctattatttaactctttca
tatcaattgaaagaaacgactgcctatgcatctgctggtcatgaattagctaccgcacag
tttgaattgccaattgcaacaccagggattgagatcacaccagttggctcgctaatggca
aaggaaattggccctcatttatacattgaaggaccaaacttttcaattaattttgataaa
gtgaagggcgccttaacgaatgtgacacgagatggtaaaaaattattgcataaagggccg
aaatttacattttggcgggcaccaatcagtaatgatatggaaattattgatgaaatgaag
aagaaatatttcttacatttagagcatgaaattgtccgttcttttgagtggaaaaaagtt
gatgattttatccaagtcatcgtaaaaacaattaacggaacgactaacagtgcttggcat
tatcaatgtacctatcagtatttaattgcaccaaatggcgaaattttcttcgacttaaaa
ggtagtcctgctggtaaaattgaaaatgcgccagatatgttaccacgtttgggtgtgact
ctccatttagacaagtctctatcagaagtaaaatatttcggtaaagggccgagagaaaac
tatgtagattcacaagaagctggtttacttggcgtttatgatgctacagtggcggaaatg
ttcactaattatgttgttccacaagccaatggtaaccacatggcgactaaatggtccgca
ttcacggatgatcgcggccaaggggtagtagcaacagcggctgattcatataattttagt
gtttcttattttgaagaacaagcgctagatgttgctaagcataccaatgaattacaagaa
agtgagtatgttgttttaaatatcgattacaaacaaaacgccctaggtagctactcttgc
ggccagtggcaattagaaaaataccgaactacgtttgaagaattccaattggcattccgc
ttaacaccttttaataataaagagattcaagcagcggatgtcgcacatgaacgagtaaaa
cgaccaacaatttcttaa

DBGET integrated database retrieval system