KEGG   Enterococcus faecalis V583: EF2973Help
Entry
EF2973            CDS       T00123                                 

Gene name
phoZ
Definition
(RefSeq) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
efa  Enterococcus faecalis V583
Pathway
Aminobenzoate degradation
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    EF2973 (phoZ)
   00790 Folate biosynthesis
    EF2973 (phoZ)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    EF2973 (phoZ)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EF2973 (phoZ)
Enzymes [BR:efa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     EF2973 (phoZ)
Exosome [BR:efa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EF2973 (phoZ)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:efa00537]
 Enzymes
  EF2973 (phoZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2844613..2846028)
Genome map
AA seq 471 aa AA seqDB search
MKKRALLGVTLLTFTTLAGCTNLSEQKSGEKQTEVAEAKATESEKASVKNVIFMIGDGMG
NPYTTGYRYFKANHSDKRVPQTAFDTYLVGQQATYPEDEEENVTDSASAATAMAAGVKTY
NNAIALDNDKSKTETVLERAKKVGKSTGLVATSEITHATPAAYGAHNVSRKNMAEIADDY
FDDQIDGQHKVDVLLGGGSELFARKDRDLVKEFSQAGYGHVTDKKSLNENQDDKILGLFA
PGGLPKMIDRTEEVPSLADMTEAALQRLDKNEKGFFLMVEGSQIDWAGHSNDIVGAMSEM
QDFEAAFEKAIDFAKKDGETLVVTTADHSTGGLSLGKGDQYNWLTEPLHAAKRTPDFMAE
EIIKNGNVEKTVTEYIDFQLSEAELKAVKTASESKDVEKIAQALRKIFDERSNTGWTTGG
HTGEDVNVYAYGPQAEAFSGQIDNTDQAKIIFGLVDGTGQKAEIKDKGIGK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagagctttgctaggggttaccttattaacattcacaacattagcgggttgt
acaaatttatctgaacagaaaagcggcgaaaaacaaacagaggttgctgaagcgaaggca
actgaatctgaaaaagcatcagtaaaaaatgttatttttatgattggagatggcatgggg
aatccgtatacaacgggctatcgctatttcaaagccaatcactcagacaagcgtgttccc
caaacagcttttgatacctatttggtcggacagcaagccacttatccagaagatgaagaa
gagaatgtcaccgattcagcttccgcagcgacagcgatggctgccggagtgaaaacctat
aataatgctattgcactcgataatgacaagtccaaaacagaaacagtgctcgaacgtgcg
aaaaaagtggggaaatcaacgggtcttgtagcaacatctgaaataacacatgcaacccct
gctgcatatggcgcacataatgtttcacgcaaaaatatggcagaaatcgccgatgactat
tttgatgatcaaatcgacggacaacacaaagtcgatgtgttacttggcggcggctccgaa
ttatttgcccggaaagatcgtgatttagtcaaagaattttcccaagcgggttatggtcat
gtcacagacaaaaagtcgttaaatgagaaccaagacgacaaaattttaggcttgtttgca
ccaggcgggctacctaaaatgattgaccgaacggaagaagtcccttcattagctgatatg
acagaagcggctcttcaacggttagataaaaatgaaaaaggtttctttttaatggttgaa
ggtagtcaaattgattgggccgggcatagcaatgatattgttggcgcgatgagcgaaatg
caagacttcgaagcggcgtttgaaaaggccatcgattttgccaaaaaagatggtgaaaca
ttggtggttacaactgcagatcattcaacagggggcttgtctttaggcaaaggagatcaa
tacaactggttgacggagcctttacatgcggcaaaacgcacgcctgatttcatggcagaa
gaaattattaaaaatggtaatgtggaaaaaacagtgactgagtatattgattttcaatta
agtgaggctgaattgaaagcagtgaaaacagcgtcggagtcaaaagatgttgaaaaaatc
gctcaggcattaagaaagatttttgatgaacgttcgaatactggttggactactggcgga
cacacaggagaagatgtaaatgtctatgcttatggcccacaagcagaagctttttcagga
caaattgataatacagaccaagcgaagattatttttggcttagtagatggcaccgggcaa
aaagctgagattaaagataaaggtattggcaaataa

DBGET integrated database retrieval system