KEGG   Enterococcus faecalis V583: EF3127Help
Entry
EF3127            CDS       T00123                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00230  Purine metabolism
efa01100  Metabolic pathways
Module
efa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EF3127 (gmk)
Enzymes [BR:efa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     EF3127 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_22 RsgA_GTPase ABC_tran
Motif
Other DBs
NCBI-GeneID: 1201971
NCBI-ProteinID: NP_816736
UniProt: Q82ZD5
Position
complement(3003545..3004159)
Genome map
AA seq 204 aa AA seqDB search
MSERGLLIVLSGPSGVGKGTVRKAIFDSEENDFQYSISMTTRKQREGEVDGVDYYFRSRE
EFEAMIEAGEMLEYAEYVGNYYGTPLTYVNQTLDEGKDVFLEIEVQGAKQVKDKVPDGVF
IFLTPPDLAELKSRIIGRGTDEMSVIEERMAVAREEIEMMALYDYAVVNDEVPLAVQRIK
DIIASEHFRVDRVIGKYIKMLEEM
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcgcgggttattaatcgtattgtcaggtccttcaggagtggggaaagggact
gtaagaaaggctattttcgacagtgaagaaaatgattttcaatattcaatctcaatgacc
actcggaaacagcgagaaggcgaagtggatggagtagattactatttccgttcaagagaa
gaatttgaagcgatgattgaagctggagaaatgttggaatatgcggaatatgttggtaac
tattatgggacaccattaacgtatgttaaccagacgttagatgaaggcaaagacgtcttt
ttagaaattgaagtccaaggggctaaacaagtcaaagacaaagtgcctgatggcgtattt
atctttttgacaccccccgatttagcggaattaaaatcaagaattattggccgcggaaca
gacgaaatgtctgtgattgaagaacgaatggctgtggccagagaagaaatcgaaatgatg
gcgctgtatgattatgcggtagtgaatgatgaagttcctttagccgtgcaacgaattaaa
gacattatcgcgagtgagcacttccgtgttgaccgtgtaattggaaaatatattaaaatg
ttagaggagatgtag

DBGET integrated database retrieval system