KEGG   Enterococcus faecalis V583: EF3178Help
Entry
EF3178            CDS       T00123                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
efa  Enterococcus faecalis V583
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:efa01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:efa00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3050944..3052080)
Genome map
AA seq 378 aa AA seqDB search
MEKSEKISILQDVVKIKSVNGNEEEVAIYLQNLLKKYEIPSELVSYAPNRSSLVAYLGEN
REKVLGFSGHMDVVSEGDESQWTFPPFAAHIEGNKLYGRGATDMKSGLVAMVLAMIELKE
KKVPLNGAVKFLGTVGEEVGELGAGQLTEKGYADDLSALVIGEPTNYNLMYAHMGSINYS
VVSHGKEAHSSMPEEGINAINNLNEFITEANQQMAEVTANYENPELGRTIHNVTVIKGGT
QVNSIPGQAALQGNIRSIPEFSNDQVIALLQKIVDELNKKEKHQLELTIDYNKIPVKAEK
DSALIQAIQAQFDQPLPLVTSAGTTDLAEFTKSDNTFDCVVFGPGVTTTAHQVDEYVEID
NYLDMIDKYQAIAKSYLN
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatcagaaaaaattagtattttacaagatgtggttaaaattaaatctgtaaat
ggaaacgaagaagaagtggcaatctatttacaaaatcttttgaagaaatatgagatccct
tctgaacttgtttcttatgcaccaaatcgtagtagtttggttgcttatttaggtgaaaac
cgagaaaaagtcttagggtttagtggccacatggacgtggtttctgaaggggacgaaagt
caatggactttcccaccatttgcggcccatattgaaggaaataaattgtatggccgtggc
gcaacggacatgaaaagcggcttagtcgcaatggttttagcaatgattgaattaaaagaa
aagaaagtcccattaaatggagcggttaaatttttaggtacagttggtgaagaagtcggt
gagctaggtgctggccaattaactgaaaaaggctatgcggatgatttaagtgccttagtc
attggagaaccaaccaattataacttgatgtatgcgcacatgggttcaattaactactcc
gttgtgtcacacggaaaagaagcccacagttcgatgccagaagaaggcattaacgcgatt
aataatttgaacgaatttattacagaagcaaaccaacaaatggcggaagtcacagcaaac
tatgaaaatcctgaattaggccgaacgattcacaatgtaaccgtcattaaaggtggcaca
caagtgaacagtattccaggtcaagcagccttgcaagggaatatccgttcaattccagaa
ttcagcaacgaccaagtcattgcattattacaaaaaattgtcgatgaattgaacaaaaaa
gaaaaacatcagttagaattaacgattgattacaataaaattcctgtaaaagctgagaaa
gattctgcgttaattcaagccattcaagcccaatttgatcaaccattaccattagtgaca
agcgctgggaccacagacttagctgaatttactaaatcagacaatacatttgattgcgtt
gtctttggaccaggtgtgaccactactgcacaccaagtcgacgaatatgtcgaaattgat
aattatttagatatgattgataagtatcaagcgatagcaaaaagttatttaaattaa

DBGET integrated database retrieval system