KEGG   Enterococcus faecalis V583: EF3178Help
Entry
EF3178            CDS       T00123                                 

Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00300  Lysine biosynthesis
efa01100  Metabolic pathways
efa01120  Microbial metabolism in diverse environments
efa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    EF3178
Enzymes [BR:efa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     EF3178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-GeneID: 1202017
NCBI-ProteinID: NP_816782
UniProt: Q82Z92
Position
complement(3050944..3052080)
Genome map
AA seq 378 aa AA seqDB search
MEKSEKISILQDVVKIKSVNGNEEEVAIYLQNLLKKYEIPSELVSYAPNRSSLVAYLGEN
REKVLGFSGHMDVVSEGDESQWTFPPFAAHIEGNKLYGRGATDMKSGLVAMVLAMIELKE
KKVPLNGAVKFLGTVGEEVGELGAGQLTEKGYADDLSALVIGEPTNYNLMYAHMGSINYS
VVSHGKEAHSSMPEEGINAINNLNEFITEANQQMAEVTANYENPELGRTIHNVTVIKGGT
QVNSIPGQAALQGNIRSIPEFSNDQVIALLQKIVDELNKKEKHQLELTIDYNKIPVKAEK
DSALIQAIQAQFDQPLPLVTSAGTTDLAEFTKSDNTFDCVVFGPGVTTTAHQVDEYVEID
NYLDMIDKYQAIAKSYLN
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatcagaaaaaattagtattttacaagatgtggttaaaattaaatctgtaaat
ggaaacgaagaagaagtggcaatctatttacaaaatcttttgaagaaatatgagatccct
tctgaacttgtttcttatgcaccaaatcgtagtagtttggttgcttatttaggtgaaaac
cgagaaaaagtcttagggtttagtggccacatggacgtggtttctgaaggggacgaaagt
caatggactttcccaccatttgcggcccatattgaaggaaataaattgtatggccgtggc
gcaacggacatgaaaagcggcttagtcgcaatggttttagcaatgattgaattaaaagaa
aagaaagtcccattaaatggagcggttaaatttttaggtacagttggtgaagaagtcggt
gagctaggtgctggccaattaactgaaaaaggctatgcggatgatttaagtgccttagtc
attggagaaccaaccaattataacttgatgtatgcgcacatgggttcaattaactactcc
gttgtgtcacacggaaaagaagcccacagttcgatgccagaagaaggcattaacgcgatt
aataatttgaacgaatttattacagaagcaaaccaacaaatggcggaagtcacagcaaac
tatgaaaatcctgaattaggccgaacgattcacaatgtaaccgtcattaaaggtggcaca
caagtgaacagtattccaggtcaagcagccttgcaagggaatatccgttcaattccagaa
ttcagcaacgaccaagtcattgcattattacaaaaaattgtcgatgaattgaacaaaaaa
gaaaaacatcagttagaattaacgattgattacaataaaattcctgtaaaagctgagaaa
gattctgcgttaattcaagccattcaagcccaatttgatcaaccattaccattagtgaca
agcgctgggaccacagacttagctgaatttactaaatcagacaatacatttgattgcgtt
gtctttggaccaggtgtgaccactactgcacaccaagtcgacgaatatgtcgaaattgat
aattatttagatatgattgataagtatcaagcgatagcaaaaagttatttaaattaa

DBGET integrated database retrieval system