KEGG   Enterococcus faecium Aus0085: EFAU085_01082Help
Entry
EFAU085_01082     CDS       T02788                                 

Definition
Class II Aldolase and Adducin N-terminal domain protein (EC:4.-.-.-)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
efau  Enterococcus faecium Aus0085
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:efau00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EFAU085_01082
Enzymes [BR:efau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     EFAU085_01082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1083171..1083923
Genome map
AA seq 250 aa AA seqDB search
MSDGRMLFERERQDMARIVRVIFERKNTNVAGGNFSFKTTDDQGKDYIIMTPTMMSEAYL
GEISPAQVLVVEPRTRRIVDGVGHLTREINMHEAMYETNPAIKAVLHAHAPNAMFWATTG
LPMPNLTEATAKVKEIPVMDFEPNCSEELAELTSDYVKKQHLELPHMLLLNSHGVLINTG
GESGIEAIHKALQILDTVEWNAEIAYKQTIFQALGITDGFYSKGEKIGGLEELKHKTAIY
NKSVIAAGGD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatggacgtatgttatttgagagagaacgacaggacatggcacgtatcgtaaga
gtgattttcgaaaggaaaaacacaaatgtcgcaggagggaatttttcctttaaaaccact
gatgatcaagggaaagactacatcatcatgacgccgaccatgatgtcagaagcctatcta
ggagagatttctcctgcacaggttctagtagtagaaccaagaacgcgtagaatcgttgac
ggagtcggtcatttaactcgtgaaatcaatatgcatgaagcgatgtatgagactaatcca
gctatcaaagctgtcctacatgctcatgcgcctaatgcaatgttctgggcgactactggg
ttgcctatgcctaatttgacagaagccacagctaaagtaaaagagattcctgtcatggac
tttgagcctaattgctctgaagaacttgctgaattgacaagcgactatgtaaaaaaacag
catctcgaattaccgcatatgttgctgctcaactctcatggcgtattgatcaacacaggt
ggagaatcaggaatcgaagctatccataaagcactgcaaatccttgatacagttgaatgg
aatgcagaaattgcctacaagcagacgatttttcaagcattagggattactgacggtttt
tattcaaaaggtgagaaaatcgggggattggaagagttgaaacataaaacggctatttat
aataaatctgttattgcagctggtggagactaa

DBGET integrated database retrieval system