KEGG   Enterococcus faecium Aus0085: EFAU085_01205Help
Entry
EFAU085_01205     CDS       T02788                                 

Gene name
alaT
Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
efau  Enterococcus faecium Aus0085
Pathway
efau00220  Arginine biosynthesis
efau00250  Alanine, aspartate and glutamate metabolism
efau00290  Valine, leucine and isoleucine biosynthesis
efau01100  Metabolic pathways
efau01110  Biosynthesis of secondary metabolites
efau01130  Biosynthesis of antibiotics
efau01210  2-Oxocarboxylic acid metabolism
efau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:efau00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EFAU085_01205 (alaT)
   00290 Valine, leucine and isoleucine biosynthesis
    EFAU085_01205 (alaT)
   00220 Arginine biosynthesis
    EFAU085_01205 (alaT)
Enzymes [BR:efau01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     EFAU085_01205 (alaT)
    2.6.1.66  valine---pyruvate transaminase
     EFAU085_01205 (alaT)
Amino acid related enzymes [BR:efau01007]
 Aminotransferase (transaminase)
  Class I
   EFAU085_01205 (alaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGS75159
Position
1211728..1212948
Genome map
AA seq 406 aa AA seqDB search
MMREFEKSNKLEGVSYDVRGPVLEEAERMQEEGISILKLNTGNPAPFGFEAPNEVIRDLI
MNARDSEGYSDSKGIFSARKAIEQYCQLKHFPNVTINDIYTGNGVSELITMCMQGLLDNG
DEVLVPMPDYPLWTASIALAGGTPVHYICDEEAEWYPDIDDIKSKITSRTKAIVIINPNN
PTGALYPKELLEEIVEVARQNNLIIYSDEIYDRLVMDGLEHIPIATLAPDLFVVTLNGLS
KSHRVAGFRVGWMVLSGDKSHVKGYIEGLNMLSSMRLCSNVLSQQIIQTALGGYQSVDEL
LLPGGRIYEQREYIYNAINDIPGLSAVKPKAAFYIFPKIDTKRFNILDDEKFVLDFLHEH
HILLVHGGGFNWNQPDHFRIVYLPKMDDLKQTAKKMREFLATYRQK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgatgagagaatttgaaaaatccaacaaattagaaggtgtcagttacgatgttcgcggt
cccgttctagaagaagcggagcggatgcaagaagagggcattagtattttaaaattgaac
acgggaaatcccgcaccttttggatttgaagcaccaaacgaagtcattcgtgatttgatc
atgaatgcccgtgactcagaaggctactcagattccaaggggatcttttctgctagaaaa
gcaattgagcaatattgccaactgaaacattttccgaatgtgacgatcaatgatatctac
accggcaacggagtgagcgaattgatcacgatgtgtatgcaggggttgctggacaatgga
gatgaagtactggttccaatgccggactatccgttgtggacggcttctattgcattagct
ggaggcacacctgttcattatatttgcgatgaagaggcagaatggtatcctgatattgat
gatatcaaatcaaaaataacgagtcggacaaaagctattgttatcattaatcctaataat
cctactggggcactttatccaaaagaattattagaagaaatcgttgaagtagctcgacaa
aataacctgattatttattccgacgaaatctatgatcgcttagtgatggatggtctagaa
catattccgattgctacattagcgcctgatttgttcgttgttacgctgaacggtctatcc
aaatctcatcgtgtagcaggatttcgagtaggctggatggtcctaagtggagataagtca
cacgtcaaaggctatatagaagggctgaatatgttgtcctccatgcgtttgtgttccaat
gtattgtctcagcaaattatccaaaccgcgctaggcggttatcaaagtgtcgatgagctg
ctcctgccaggcggaaggatctatgaacaaagagaatatatctataatgcaatcaatgat
attcctggtctttcagccgtaaaaccaaaagctgctttttatatattcccaaaaattgat
acaaagcgattcaatattttggatgatgaaaaattcgttttggactttttacatgaacat
catattctacttgtacatggtggtggatttaattggaaccagccagatcattttcgaatc
gtttatcttcctaaaatggatgatttgaaacaaacagctaagaaaatgagagaattccta
gcaacctatcgccaaaaatga

DBGET integrated database retrieval system