KEGG   Enterococcus faecium Aus0085: EFAU085_02368Help
Entry
EFAU085_02368     CDS       T02788                                 

Gene name
tdk
Definition
Thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
efau  Enterococcus faecium Aus0085
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efau00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EFAU085_02368 (tdk)
Enzymes [BR:efau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     EFAU085_02368 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2375338..2375934)
Genome map
AA seq 198 aa AA seqDB search
MKKSMAQLFFKYGAMNSGKTIEILKVAHNYEEQNKPVVLMTSGIDTRDGLGVVSSRIGLK
RNAMPIFEETDVFDVIQKMESKPYCVLIDEAQFLKKKHVIAFTRIVDELDIPVMAFGLKN
DFRNELFEGSKYLLLYADKIEEMKTICWFCHKKAIMNLHYIDGNPVYEGDQVQIGGNEAY
YPVCRKHYFHPSMITEGE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagagcatggcacaactattttttaagtatggcgcaatgaatagcggcaagacg
atcgagatcctaaaagtcgcacataattatgaagaacaaaataagccagttgtcttaatg
acaagcggtattgatacaagagatggtttaggcgttgtttcaagccgaatcggactgaaa
cgtaatgcgatgccgatatttgaagaaacagacgtatttgacgtaattcagaaaatggaa
agcaaaccctattgtgtgctgatcgatgaagcgcaattcttaaaaaagaaacatgtcatt
gcttttacgagaattgtggacgaattggatattccggttatggcatttggtttgaaaaat
gattttcgaaacgagttatttgaaggatcaaaatatttattgctttatgcagacaaaatc
gaagaaatgaaaacaatctgttggttctgccacaaaaaagcaatcatgaatttacattat
attgatggaaaccctgtttatgaaggcgatcaagtgcaaattggcggaaatgaagcttat
taccccgtttgtcgaaaacattactttcacccatcaatgattacagaaggagaataa

DBGET integrated database retrieval system