KEGG   Enterococcus faecium Aus0085: EFAU085_02635Help
Entry
EFAU085_02635     CDS       T02788                                 

Definition
penicillin-binding protein, 1A family (EC:2.4.2.-)
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
efau  Enterococcus faecium Aus0085
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:efau00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EFAU085_02635
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    EFAU085_02635
Enzymes [BR:efau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     EFAU085_02635
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     EFAU085_02635
Glycosyltransferases [BR:efau01003]
 Polysaccharide
  Bacterial polysaccharide
   EFAU085_02635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2641159..2643330)
Genome map
AA seq 723 aa AA seqDB search
MDFQSILEKIKAALISFWRWIRPYLGQFHRWRKRIWKKYHVNKLILLIGLICVLVTSIYL
FILAKQANVETLKSGLSQSTVIYDKKNEEAGTLYAQKGTYVELNAISPYIQDAVISTEDR
NFYEHHGFDIKGIARAAVRMVLSGGTSGGGGSTITQQLAKNAYLTLDQTFDRKAKELFLA
IEIEKKYSKEEILTMYLNNAYFGNGVWGVQDASRKYFGVDATNVTLSEAATLAGMLKGPG
IYNPIDHPKNANDRKNTVLSVMEENGKITKEQEQAESQTDISAYLNDTYDNSDSGYRYPY
YFDAVIDEAVNEYGLDEEDVMNKGYKIYTALDQDYQKQLEATYQNSALFPANASDGAMVQ
SASVALDPNTGGVQALVGRRGDHVFRGFSFATQMRRSPGSTIKPLSVYTPALEAGYKPSS
ILKDEPQSYYDAHNFDGTYQGEVPMYQAVAQSLNLPAVWLLHEIGLQKGYDKAEEFGLPL
AKSDKYYGLALGGLEKGVSPLIMAGAYSAFANDGQMYTPHLITKIVDSTGAVIVDNTNKK
PKQVISKETADEMTSMLLGTFSNGTAAAANPAGYTIAGKTGTTETNFDATKANDQWMIGY
TPDVVISTWMGYEESSKLHYLEGTSGNVVGKVFKSAAEGILPYTSKTGFSVADAYATGGQ
VVAADQVGNTGNSNGESGNWQDNLNQYGEQAKEGLKNFGDMVKEGVQGIGEAAKDLWRKY
QGE
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggattttcaaagcattttagaaaagataaaagctgctttgatcagtttttggcgttgg
atcagaccatatctcggacaattccatcgatggcgaaagcgcatctggaaaaaatatcat
gtgaacaaattgattttgctgattggtttgatctgtgtcttagtgacaagtatctacctc
tttattttagcaaaacaagcaaatgtcgaaacgttaaaatcaggattaagccaatcgaca
gtcatttatgataagaaaaacgaagaagctggcacactgtacgcccaaaaaggaacatat
gtagaattaaacgcgatttctccctatatccaagatgcagtaatctcgacagaagatagg
aatttttacgagcatcacgggtttgatatcaaagggattgcccgtgcagcagtccgaatg
gtcttgtctggcggaacatcagggggcggaggaagtacgatcactcagcagcttgccaaa
aatgcgtatctgacattagaccaaacgtttgatcgaaaagcgaaggaattatttttggca
atcgagatcgaaaagaagtacagcaaagaagaaatcttgaccatgtatcttaacaatgcc
tattttggcaacggggtatggggtgtccaagacgcttccagaaagtattttggagtagat
gcaacgaatgttacgctgtctgaggctgctactttggcaggaatgctgaaaggtcctggt
atttataatccgatcgatcacccaaaaaatgcgaatgatcggaaaaacacagtactaagt
gtaatggaagaaaacggaaaaatcacaaaagaacaagaacaagcagaaagccagacagat
atcagcgcgtatcttaatgacacatacgataattcagattctggttatcgttatccttat
tattttgatgcagtgatcgatgaagcagttaacgagtatggtcttgatgaagaagatgtc
atgaataaaggctataaaatctatacagctttagatcaggattatcaaaagcaattagaa
gctacttatcaaaacagtgcattattcccagcaaatgcttcagatggtgccatggtccaa
tctgcttcagtagctttagatccgaatacaggtggtgtacaagcactagtaggacgaaga
ggagatcatgtctttagaggattcagctttgctacacagatgcgtcgttcaccaggatca
acgatcaaaccattaagcgtatatacaccagcactggaagctggatacaagccttccagt
atcttgaaagacgaaccgcaaagttattacgatgcgcataattttgacgggacataccaa
ggagaagtaccgatgtatcaagctgttgcacaaagtttgaatttgcctgctgtatggctt
ttgcatgagatcggtttacaaaaaggatatgataaagcagaagaattcggcctgccttta
gcaaaatctgataagtattatggcttagcccttggtggactggaaaaaggagtatctcca
ttgatcatggcgggtgcttacagtgcatttgccaatgatggtcagatgtatacgccgcat
cttatcacgaaaatcgttgattcgactggagcggtgatcgtcgataacacaaacaaaaaa
ccaaaacaggtcatatcaaaggaaacagccgatgaaatgaccagcatgcttcttggtaca
ttttcaaatggaacagcggctgctgcgaatcctgcaggttatacgatagcagggaaaaca
ggaaccacagaaactaatttcgatgccacaaaagcaaatgaccaatggatgatcggttac
acgccagacgtagtgatttcgacatggatgggttacgaagaatccagcaagctgcactat
ttggaagggacaagtggaaatgttgtcgggaaagtcttcaaatcagcggcagaaggcatc
cttccgtatacttcaaaaacaggatttagtgtagcagatgcctatgccacaggaggacaa
gtggtagctgcagatcaagttggaaacacaggaaattctaatggagagtctggaaattgg
caagataacttgaatcaatatggtgaacaagcaaaagaagggctgaaaaacttcggcgat
atggtgaaagaaggcgttcagggaattggtgaagcggctaaagacctctggcggaaatat
caaggagagtag

DBGET integrated database retrieval system