KEGG   Enterococcus faecium Aus0004: EFAU004_00066Help
Entry
EFAU004_00066     CDS       T01772                                 

Gene name
dhfr_2
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
efc  Enterococcus faecium Aus0004
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:efc00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:efc00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(68722..69219)
Genome map
AA seq 165 aa AA seqDB search
MKVSLIAAMDKNRVIGKENDIPWRIPKDWEYVKNTTKGHPIILGRKNLESIGRALPDRRN
IILTRDKGFTFNGCEIVHSIEDVFELCKNEEEIFIFGGEQIYNLFFPYVEKMYITKIHHE
FEGDTFFPEVNYEEWNEVFAQKGIKNDKNPYNYYFHVYERKNLLS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttctttgattgctgcgatggataagaatagagtgattggcaaagagaatgac
attccttggaggattcccaaggactgggaatatgttaaaaatactacaaagggacatccg
ataatattaggtaggaagaaccttgaatcaatcggaagagccttacctgacagaagaaat
attattctgacgagagataaggggtttacctttaatggttgtgaaattgttcattcaata
gaagatgtttttgagttatgtaaaaacgaagaagaaatttttattttcggaggagaacag
atttataatttgtttttcccttatgttgagaaaatgtacatcacaaaaatacatcatgaa
ttcgaaggagatactttttttccagaagtgaattatgaggaatggaatgaggtatttgcc
caaaaagggataaagaatgataaaaatccgtataactactattttcatgtatatgaaaga
aaaaacttattgagttaa

DBGET integrated database retrieval system