KEGG   Enterococcus faecium Aus0004: EFAU004_00087Help
Entry
EFAU004_00087     CDS       T01772                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
efc  Enterococcus faecium Aus0004
Pathway
efc00010  Glycolysis / Gluconeogenesis
efc00260  Glycine, serine and threonine metabolism
efc00680  Methane metabolism
efc01100  Metabolic pathways
efc01110  Biosynthesis of secondary metabolites
efc01120  Microbial metabolism in diverse environments
efc01130  Biosynthesis of antibiotics
efc01200  Carbon metabolism
efc01230  Biosynthesis of amino acids
Module
efc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
efc_M00002  Glycolysis, core module involving three-carbon compounds
efc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFAU004_00087 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EFAU004_00087 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EFAU004_00087 (gpmA)
Enzymes [BR:efc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EFAU004_00087 (gpmA)
Membrane trafficking [BR:efc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EFAU004_00087 (gpmA)
Exosome [BR:efc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EFAU004_00087 (gpmA)
  Exosomal proteins of melanoma cells
   EFAU004_00087 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFC62173
Position
complement(89858..90544)
Genome map
AA seq 228 aa AA seqDB search
MPKLVFSRHGLSEWNALNQFTGWADVNLAPEGIEEAKEGGRKIKEAGIEFDVAYTSVLTR
AIKTCNLILEYSDQLWVPQIKSWRLNERHYGKLQGLNKKETAEKYGDEQVHIWRRSYDTL
PPLMEETDEGSAANDRRYAMLDKRDIPGGENLKVTLERALPFWQDEIAPALLDNKTVLVA
AHGNSLRALAKHIEGISDEDIMDLEIPTGQPLVYELNDDLTVAKKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagttttttctcgtcacggtcttagtgaatggaatgcattgaaccaattt
actggttgggctgatgtaaatctagcaccagaaggaatcgaagaagcaaaagaaggcgga
cgcaaaatcaaagaagctggaatcgaatttgatgttgcttacacttctgttttaactcgt
gcaatcaaaacatgtaacttgatcttagaatattcagatcaactttgggtaccacaaatc
aaatcatggcgcttaaacgaacgtcactatggtaaattacaaggtttgaacaaaaaagaa
acagctgaaaaatacggcgacgaacaagtgcacatctggcgtcgttcttacgatactctt
cctccattaatggaagaaactgacgaaggttctgcagcaaatgaccgtcgttacgcaatg
ttagacaaacgcgatattcctggtggagaaaacttgaaagtgacattagaacgcgctttg
ccattctggcaagatgaaattgctccagcattactagacaacaaaactgttttagtagct
gcacatggtaactcattacgcgccctagctaaacatatcgaaggtatctctgacgaagac
atcatggatcttgaaattccaacaggtcaaccacttgtttatgaattaaatgatgactta
acagttgctaaaaaatactacctataa

DBGET integrated database retrieval system