KEGG   Enterococcus faecium Aus0004: EFAU004_00087Help
Entry
EFAU004_00087     CDS       T01772                                 

Gene name
gpmA
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EFAU004_00087 (gpmA)
   01230 Biosynthesis of amino acids
    EFAU004_00087 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFAU004_00087 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EFAU004_00087 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EFAU004_00087 (gpmA)
Enzymes [BR:efc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EFAU004_00087 (gpmA)
Exosome [BR:efc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EFAU004_00087 (gpmA)
  Exosomal proteins of melanoma cells
   EFAU004_00087 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(89858..90544)
Genome map
AA seq 228 aa AA seqDB search
MPKLVFSRHGLSEWNALNQFTGWADVNLAPEGIEEAKEGGRKIKEAGIEFDVAYTSVLTR
AIKTCNLILEYSDQLWVPQIKSWRLNERHYGKLQGLNKKETAEKYGDEQVHIWRRSYDTL
PPLMEETDEGSAANDRRYAMLDKRDIPGGENLKVTLERALPFWQDEIAPALLDNKTVLVA
AHGNSLRALAKHIEGISDEDIMDLEIPTGQPLVYELNDDLTVAKKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagttttttctcgtcacggtcttagtgaatggaatgcattgaaccaattt
actggttgggctgatgtaaatctagcaccagaaggaatcgaagaagcaaaagaaggcgga
cgcaaaatcaaagaagctggaatcgaatttgatgttgcttacacttctgttttaactcgt
gcaatcaaaacatgtaacttgatcttagaatattcagatcaactttgggtaccacaaatc
aaatcatggcgcttaaacgaacgtcactatggtaaattacaaggtttgaacaaaaaagaa
acagctgaaaaatacggcgacgaacaagtgcacatctggcgtcgttcttacgatactctt
cctccattaatggaagaaactgacgaaggttctgcagcaaatgaccgtcgttacgcaatg
ttagacaaacgcgatattcctggtggagaaaacttgaaagtgacattagaacgcgctttg
ccattctggcaagatgaaattgctccagcattactagacaacaaaactgttttagtagct
gcacatggtaactcattacgcgccctagctaaacatatcgaaggtatctctgacgaagac
atcatggatcttgaaattccaacaggtcaaccacttgtttatgaattaaatgatgactta
acagttgctaaaaaatactacctataa

DBGET integrated database retrieval system