KEGG   Enterococcus faecium Aus0004: EFAU004_00239Help
Entry
EFAU004_00239     CDS       T01772                                 

Definition
aldehyde-alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EFAU004_00239
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFAU004_00239
   00620 Pyruvate metabolism
    EFAU004_00239
   00650 Butanoate metabolism
    EFAU004_00239
  Lipid metabolism
   00071 Fatty acid degradation
    EFAU004_00239
  Amino acid metabolism
   00350 Tyrosine metabolism
    EFAU004_00239
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EFAU004_00239
   00626 Naphthalene degradation
    EFAU004_00239
Enzymes [BR:efc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EFAU004_00239
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EFAU004_00239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237493..240090
Genome map
AA seq 865 aa AA seqDB search
MAKVIEKEKTKTIDVQAMIDDLAEKANAALKEMESFDQEKVDHIVHEMAMAALDQHMPLA
KMAVEETGRGVYEDKAIKNMYASEYIWHNIKHDKTVGVINEDVQKGLIEIAEPVGVVCGV
TPTTNPTSTTIFKSMIALKTRNPIVFAFHPSAQKSSAEAARVVRDAAIAAGAPENCIQWI
EHPSIEATSMLMNHPGIAIVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIEKTAKIKRA
VNDLIVSKTFDNGMICASEQAVIVDKEIYAAVKAEFQAHQVYIVKPDELQKLEDAVMNEG
KYAVNPSIVGHSAMEIAKLAGISVPKGTKMLIAELEGVGPDYPLSREKLSPVLAMIKANN
TDHAFDLCEGMLNLGGLGHTAVIHSENEELHVKFGLRMKACRILVNTPSAEGGIGDIYNE
MIPSLTLGCGSYGKNSVSRNVSAVNLINVKTVAKRRNNMQWFKLPPKIFFEKNSLLYLEK
MENVERVMIVCDPGMVQFGYCDTVREVLARRKNDVKIEVFSDVEPNPSTNTVYAGTKLMA
DFKPDTVIALGGGSAMDAAKGMWMFYEHPDTSFFGAKQKFLDIRKRTYKIDKPEKTQFVC
IPTTSGTGSEVTPFAVITDSETHVKYPLADYALTPDVAIVDPQFVMSVPASVTADTGMDV
LTHAIESYVSVMASDYTRGLSLQAIKLVFDYLEKSVKTPDMESREKMHNASTMAGMAFAN
AFLGICHSVAHKIGGEYGIPHGRTNAILLPHIIRYNAKDPQKHAMFPKYDYFRADTDYAD
IAKFLGLKGETTEELVEALATAVYELGKSVGINMSLKAQGVTQETLDTTVDRMAELAYED
QCTTANPKEPLISELKQIIIDAYNG
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagtaatagaaaaagaaaaaacgaagacaattgacgtacaagcaatgattgat
gatttggcagaaaaagcaaatgcagcattgaaagaaatggaaagctttgatcaagaaaaa
gtagaccatatcgtgcatgaaatggcaatggcagctttggatcaacatatgccattagcg
aagatggctgtagaggaaacaggccgcggtgtttacgaagataaagcaatcaaaaatatg
tatgcgtccgaatatatttggcataatatcaaacatgataaaacagttggtgtgatcaat
gaagatgtccaaaaagggttgattgaaattgctgaaccagtcggtgtggtttgcggagta
actccaacaacgaatccgacttccacaacgattttcaaatcaatgatcgcgttgaaaaca
agaaatccaatcgtttttgctttccatccaagtgcccaaaaatcttctgcagaagcagca
cgagtggtacgtgatgctgctatcgctgccggagctcctgaaaattgtatccaatggatc
gaacatccttcgatcgaagcgacttctatgctaatgaaccatccaggtatcgcgatcgtc
ttagcgacaggtggagctggaatggtcaagtctgcttactctacaggaaaaccagcttta
ggtgtaggtccaggtaacgtaccagcttatattgaaaaaacagcaaaaattaaacgtgca
gtgaacgatttgatcgtttcgaaaacatttgataatggaatgatttgtgcttctgaacaa
gctgtgatcgtggataaagaaatctatgcagcagtaaaagcagaattccaagcacaccaa
gtttatatcgtaaaaccagatgaattgcaaaaattagaagatgcagtgatgaacgaagga
aaatatgcggtcaatccatcaatcgttggacattctgcgatggaaatcgcaaaattggca
ggaatcagtgtaccaaaaggaacgaaaatgctgattgctgaattggaaggcgtaggccca
gattatccgctatcaagagaaaaactttctccagttcttgccatgatcaaagctaacaac
acggaccatgcgtttgatttgtgtgaaggtatgttgaatcttggaggattaggacataca
gcagttatccattcagaaaacgaagagttgcatgtcaaattcggtcttcgaatgaaagct
tgtcgtattttagtgaatacaccatctgcagaaggcggcatcggtgatatctataacgaa
atgattccgtcattgactttgggatgcggttcttatggtaagaactctgtttctcgtaac
gtctctgctgtaaacttaatcaatgtcaaaactgtagcgaaacggagaaataacatgcaa
tggttcaaattaccgccaaaaatcttctttgaaaagaactctctattgtacttagagaaa
atggaaaacgttgaacgtgtcatgatcgtttgtgaccctggtatggtccaattcggttac
tgcgatacagttcgtgaagtattggcacgacgtaaaaatgatgtgaagatcgaagtcttc
tcagatgttgaaccgaacccatcgacaaataccgtatacgcaggaacgaaactgatggca
gacttcaagccagatacagtaatcgctcttggaggcggttctgcaatggacgcagctaag
ggaatgtggatgttctatgaacacccagacacatctttctttggtgcaaaacaaaaattc
ttggatatccgtaaacggacatataagatcgacaaaccagaaaaaacacaattcgtatgt
atcccgacaacatcagggactggttctgaagtaacgccatttgcggtcatcactgacagt
gaaacacatgtgaaatatccgttagcagattatgcattgacgccagatgtcgcaatcgtc
gatcctcaattcgtcatgtcagttccagcatctgtcacagcagataccgggatggatgtg
ttaacacatgcaatcgaatcctatgtttcagtcatggcttcagattatacacgtggattg
agcctacaagcaatcaagttagtctttgactatttagaaaaatcagtaaaaacacctgat
atggaatcacgtgaaaaaatgcacaacgcttctacaatggctggtatggcgtttgctaac
gcattcctaggtatttgtcactcagtcgcacataaaatcggcggggaatacgggatccct
catggacggacaaatgcgattcttttaccgcatattatccgctataatgcaaaagatcca
caaaaacatgcgatgttccctaaatatgactatttccgtgcagatacagattacgcagat
atcgcaaaattcttaggtctgaaaggcgaaacaacagaggaattagtcgaagctttagca
acggctgtttatgaattaggaaaatctgtcggcatcaacatgagtctaaaagctcaagga
gtcacacaagaaacactagatacaaccgtagaccgtatggctgaattagcttacgaagac
caatgtacgacagctaatccgaaagaaccattgatctctgaattgaaacagatcatcatt
gatgcttacaacggataa

DBGET integrated database retrieval system