KEGG   Enterococcus faecium Aus0004: EFAU004_00239Help
Entry
EFAU004_00239     CDS       T01772                                 

Definition
(GenBank) aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
efc  Enterococcus faecium Aus0004
Pathway
efc00010  Glycolysis / Gluconeogenesis
efc00350  Tyrosine metabolism
efc00620  Pyruvate metabolism
efc00625  Chloroalkane and chloroalkene degradation
efc00626  Naphthalene degradation
efc00650  Butanoate metabolism
efc01100  Metabolic pathways
efc01110  Biosynthesis of secondary metabolites
efc01120  Microbial metabolism in diverse environments
efc01130  Biosynthesis of antibiotics
efc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFAU004_00239
   00620 Pyruvate metabolism
    EFAU004_00239
   00650 Butanoate metabolism
    EFAU004_00239
  Lipid metabolism
   00071 Fatty acid degradation
    EFAU004_00239
  Amino acid metabolism
   00350 Tyrosine metabolism
    EFAU004_00239
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EFAU004_00239
   00626 Naphthalene degradation
    EFAU004_00239
Enzymes [BR:efc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EFAU004_00239
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EFAU004_00239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AFC62325
Position
237493..240090
Genome map
AA seq 865 aa AA seqDB search
MAKVIEKEKTKTIDVQAMIDDLAEKANAALKEMESFDQEKVDHIVHEMAMAALDQHMPLA
KMAVEETGRGVYEDKAIKNMYASEYIWHNIKHDKTVGVINEDVQKGLIEIAEPVGVVCGV
TPTTNPTSTTIFKSMIALKTRNPIVFAFHPSAQKSSAEAARVVRDAAIAAGAPENCIQWI
EHPSIEATSMLMNHPGIAIVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIEKTAKIKRA
VNDLIVSKTFDNGMICASEQAVIVDKEIYAAVKAEFQAHQVYIVKPDELQKLEDAVMNEG
KYAVNPSIVGHSAMEIAKLAGISVPKGTKMLIAELEGVGPDYPLSREKLSPVLAMIKANN
TDHAFDLCEGMLNLGGLGHTAVIHSENEELHVKFGLRMKACRILVNTPSAEGGIGDIYNE
MIPSLTLGCGSYGKNSVSRNVSAVNLINVKTVAKRRNNMQWFKLPPKIFFEKNSLLYLEK
MENVERVMIVCDPGMVQFGYCDTVREVLARRKNDVKIEVFSDVEPNPSTNTVYAGTKLMA
DFKPDTVIALGGGSAMDAAKGMWMFYEHPDTSFFGAKQKFLDIRKRTYKIDKPEKTQFVC
IPTTSGTGSEVTPFAVITDSETHVKYPLADYALTPDVAIVDPQFVMSVPASVTADTGMDV
LTHAIESYVSVMASDYTRGLSLQAIKLVFDYLEKSVKTPDMESREKMHNASTMAGMAFAN
AFLGICHSVAHKIGGEYGIPHGRTNAILLPHIIRYNAKDPQKHAMFPKYDYFRADTDYAD
IAKFLGLKGETTEELVEALATAVYELGKSVGINMSLKAQGVTQETLDTTVDRMAELAYED
QCTTANPKEPLISELKQIIIDAYNG
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagtaatagaaaaagaaaaaacgaagacaattgacgtacaagcaatgattgat
gatttggcagaaaaagcaaatgcagcattgaaagaaatggaaagctttgatcaagaaaaa
gtagaccatatcgtgcatgaaatggcaatggcagctttggatcaacatatgccattagcg
aagatggctgtagaggaaacaggccgcggtgtttacgaagataaagcaatcaaaaatatg
tatgcgtccgaatatatttggcataatatcaaacatgataaaacagttggtgtgatcaat
gaagatgtccaaaaagggttgattgaaattgctgaaccagtcggtgtggtttgcggagta
actccaacaacgaatccgacttccacaacgattttcaaatcaatgatcgcgttgaaaaca
agaaatccaatcgtttttgctttccatccaagtgcccaaaaatcttctgcagaagcagca
cgagtggtacgtgatgctgctatcgctgccggagctcctgaaaattgtatccaatggatc
gaacatccttcgatcgaagcgacttctatgctaatgaaccatccaggtatcgcgatcgtc
ttagcgacaggtggagctggaatggtcaagtctgcttactctacaggaaaaccagcttta
ggtgtaggtccaggtaacgtaccagcttatattgaaaaaacagcaaaaattaaacgtgca
gtgaacgatttgatcgtttcgaaaacatttgataatggaatgatttgtgcttctgaacaa
gctgtgatcgtggataaagaaatctatgcagcagtaaaagcagaattccaagcacaccaa
gtttatatcgtaaaaccagatgaattgcaaaaattagaagatgcagtgatgaacgaagga
aaatatgcggtcaatccatcaatcgttggacattctgcgatggaaatcgcaaaattggca
ggaatcagtgtaccaaaaggaacgaaaatgctgattgctgaattggaaggcgtaggccca
gattatccgctatcaagagaaaaactttctccagttcttgccatgatcaaagctaacaac
acggaccatgcgtttgatttgtgtgaaggtatgttgaatcttggaggattaggacataca
gcagttatccattcagaaaacgaagagttgcatgtcaaattcggtcttcgaatgaaagct
tgtcgtattttagtgaatacaccatctgcagaaggcggcatcggtgatatctataacgaa
atgattccgtcattgactttgggatgcggttcttatggtaagaactctgtttctcgtaac
gtctctgctgtaaacttaatcaatgtcaaaactgtagcgaaacggagaaataacatgcaa
tggttcaaattaccgccaaaaatcttctttgaaaagaactctctattgtacttagagaaa
atggaaaacgttgaacgtgtcatgatcgtttgtgaccctggtatggtccaattcggttac
tgcgatacagttcgtgaagtattggcacgacgtaaaaatgatgtgaagatcgaagtcttc
tcagatgttgaaccgaacccatcgacaaataccgtatacgcaggaacgaaactgatggca
gacttcaagccagatacagtaatcgctcttggaggcggttctgcaatggacgcagctaag
ggaatgtggatgttctatgaacacccagacacatctttctttggtgcaaaacaaaaattc
ttggatatccgtaaacggacatataagatcgacaaaccagaaaaaacacaattcgtatgt
atcccgacaacatcagggactggttctgaagtaacgccatttgcggtcatcactgacagt
gaaacacatgtgaaatatccgttagcagattatgcattgacgccagatgtcgcaatcgtc
gatcctcaattcgtcatgtcagttccagcatctgtcacagcagataccgggatggatgtg
ttaacacatgcaatcgaatcctatgtttcagtcatggcttcagattatacacgtggattg
agcctacaagcaatcaagttagtctttgactatttagaaaaatcagtaaaaacacctgat
atggaatcacgtgaaaaaatgcacaacgcttctacaatggctggtatggcgtttgctaac
gcattcctaggtatttgtcactcagtcgcacataaaatcggcggggaatacgggatccct
catggacggacaaatgcgattcttttaccgcatattatccgctataatgcaaaagatcca
caaaaacatgcgatgttccctaaatatgactatttccgtgcagatacagattacgcagat
atcgcaaaattcttaggtctgaaaggcgaaacaacagaggaattagtcgaagctttagca
acggctgtttatgaattaggaaaatctgtcggcatcaacatgagtctaaaagctcaagga
gtcacacaagaaacactagatacaaccgtagaccgtatggctgaattagcttacgaagac
caatgtacgacagctaatccgaaagaaccattgatctctgaattgaaacagatcatcatt
gatgcttacaacggataa

DBGET integrated database retrieval system