KEGG   Enterococcus faecium Aus0004: EFAU004_00377Help
Entry
EFAU004_00377     CDS       T01772                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:efc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379385..380881
Genome map
AA seq 498 aa AA seqDB search
MTESTYIMAIDQGTTSSRAIIFDKKGRHIGSSQKEFTQYFPQESWVEHDANEIWNSVQSV
IAGAFIESGIKPNQIAGIGITNQRETTVIWEKDTGRPIYHAVVWQSRQSAGIADNLKNEG
YQEFFHEKTGLVIDAYFSATKIRWILDHVEGAQERAEKGELMFGTIDSWLVWKLTDGQAH
VTDYSNASRTMLFNIHQLDWDQEILDLLNIPRVMLPKVTSNSEVYGYTQGYHFYGSEAPI
SGMAGDQQAALFGQMAFEPGMVKNTYGTGSFIVMNTGEKPQLSKNNLLTTIGYGINGKVY
YALEGSIFVAGSSIQWLRDGLQMLQKASDSEDAAKRSTSEDEVYVVPAFVGLGAPYWDQA
ARGAMFGLTRGTTKEDIIKATLQSIAYQVRDIIDTMQDDTGIKIPVLKVDGGAANNEYLM
QFQTDILNVPIQRAENLETTALGAAFLAGLAVGYWKDTDEIREFYEAGKLFEVQMEEERR
EKLYNGWKKAVKATQAFE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatcaacgtatatcatggcgattgaccaaggtacaactagctcacgagcaatt
atctttgacaagaaaggaagacacatcggcagttctcaaaaagagttcacgcaatatttc
ccgcaagaaagttgggtggaacatgatgcaaatgaaatctggaattctgtacagtcagtt
attgccggagcgttcatcgaatcagggatcaaaccaaatcagattgctgggattggcata
acgaaccagcgtgaaacaacagtaatatgggaaaaagatacaggacgtccaatctatcat
gcagttgtttggcaatccagacagtcagctggaattgcagataacttaaaaaatgaaggc
tatcaagaatttttccacgaaaaaacagggttagtgatcgatgcctatttctcagcaacg
aagatacgctggattcttgatcatgtagaaggcgcgcaagaacgagctgaaaaaggcgaa
ttgatgtttggaacgatcgattcttggttagtatggaaactgaccgatggacaagcacat
gttactgattactcgaatgccagtcggacgatgttgttcaatatccatcagctagattgg
gatcaggagattttagatttactaaatattcctcgagtgatgttaccaaaagtcacttct
aactcagaagtttatggttatacgcaaggttatcatttttatggaagcgaagcaccaatt
tcagggatggcaggagaccagcaagccgcattattcggacaaatggcattcgaaccaggc
atggtcaagaatacttatggtacaggttcatttattgtcatgaataccggtgaaaaaccg
caattatccaaaaataatttattgacgacaattggttacggcataaatggaaaggtttac
tatgctttagaaggaagtatttttgtggctggttcttcgattcaatggctgagagatgga
cttcaaatgttgcaaaaagctagcgattcagaagacgcagcgaaacgctctacaagcgaa
gatgaggtttatgttgttcctgcattcgttgggctaggtgctccttattgggatcaggca
gcacgaggggctatgtttggcttgacacgtggtacgacaaaagaagatatcattaaagct
actttacagtcgattgcttatcaagtgagagatatcatcgatacgatgcaagatgacact
ggaatcaagattcctgtattgaaagtagatggcggtgcagcaaacaatgaatatctgatg
caattccaaacagatatcttgaatgtaccgatccaacgagcagaaaacttggaaacaacg
gcgctaggggcagcatttttagcaggattagctgtcggttattggaaagatacagacgag
atccgcgaattttatgaagctggcaagctatttgaagttcaaatggaggaagagcgccga
gaaaaactttacaacggttggaaaaaagcagtaaaagctacccaagcatttgaataa

DBGET integrated database retrieval system