KEGG   Enterococcus faecium Aus0004: EFAU004_00406Help
Entry
EFAU004_00406     CDS       T01772                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
efc  Enterococcus faecium Aus0004
Pathway
efc00010  Glycolysis / Gluconeogenesis
efc00052  Galactose metabolism
efc01100  Metabolic pathways
efc01110  Biosynthesis of secondary metabolites
efc01120  Microbial metabolism in diverse environments
efc01130  Biosynthesis of antibiotics
Module
efc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFAU004_00406
   00052 Galactose metabolism
    EFAU004_00406
Enzymes [BR:efc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     EFAU004_00406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFC62492
Position
complement(412600..413607)
Genome map
AA seq 335 aa AA seqDB search
MDNPEISVVPVPETEIKKITLKNDYLEVVLLNYGARLHQIFAPDKEGKSENVLLSYDRFE
DVLTDKSFFGATVGPVAGRIRDASWGEHRLEKNCGSHHIHGGTKGWSFQFWEVEVFKTPS
SIGVVFYLKDEFSTYPGPITATITYRLTKNELEMTTSASSLVETICNPTNHAYFNLSGNG
TRDIYEHQLTVFLDGVLELDQEKLPTGNWTKKEKLPIDFRKSPTLQEILACYPDGLDDVF
LLHHPRLSKTSLQLFEKHSGRQMTIATSNKSMVLFSTTGFEADFSVNGKQMHSNYGLAIE
PQEIPDIVHFPKFGSINLHPGQERISQTIYRFSAQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggataatccagagatctccgtcgtaccagttccagagactgaaataaagaaaatcaca
ttgaagaacgactacttagaagtcgttcttctcaattacggtgcccgcctgcaccaaatc
ttcgcaccagacaaagaaggaaaatcagaaaatgttttattgtcttacgatcgtttcgaa
gatgttctaacagacaaaagcttttttggagcaactgtcggacctgtagccggaaggatc
cgggatgcttcttggggtgagcatagattggagaaaaactgcggatcacaccatatccac
ggtggcacgaaaggctggtctttccaattttgggaagtagaagttttcaaaactccatca
tcaataggtgtggtcttttacttaaaagatgaattttctacctatccaggaccaatcact
gctacgatcacttaccgtttaacaaaaaacgaattagagatgacaacctctgctagtagc
cttgttgaaaccatctgcaatccgaccaaccatgcctacttcaacctttcaggaaatgga
acaagagacatctatgaacatcagttaacggtctttttagatggtgtgcttgaattagat
caagaaaaactgcctactggaaattggacaaaaaaagaaaaactgccaatcgactttaga
aaatccccaacactgcaagagatccttgcatgttatccagatggactagatgatgtattt
cttttgcatcatcctaggctttccaaaacttccttacaattattcgagaagcattctggt
cgccaaatgactatagcaacttctaataaaagtatggtattattttctacgactggattc
gaagctgatttctctgtcaatggaaaacagatgcattcaaactacggattagcaatcgaa
ccgcaagaaatccctgatatcgttcatttccccaaatttggatcgatcaacctccatcct
ggtcaagaacggatcagtcagacgatttatcggttctctgcacaataa

DBGET integrated database retrieval system