KEGG   Enterococcus faecium Aus0004: EFAU004_00442Help
Entry
EFAU004_00442     CDS       T01772                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EFAU004_00442
Enzymes [BR:efc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EFAU004_00442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(451033..451950)
Genome map
AA seq 305 aa AA seqDB search
MNTVTVIGSINMDTTLRLTNMPKPGETMHAHEIFHAGGGKGANQAVAAKRSGARTSFIGG
VGADSEGQQLLDLLTKENIDTSGIAEIQGATTGQAMIMVDAAGENSILIHAGANNAFHEQ
EVLKNKQLITNSDFIIAQFESSLDATILAFSIAKDAGKTTILNPAPARETIPTELLEKTD
IIIPNETETEIITGIRVTDHNSLVAAAEKLHELGIGTVIITLGSAGAFYHTEKEHGIVPA
FKVDAVDTTAAGDTFIGALSSTLQPDLSNLKEAILYGNLASSVAVQSYGAQPSIPYREAL
EQSAV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggttacagtaattggaagtattaatatggacactacccttcgtttaaccaac
atgcccaagccaggcgaaacgatgcatgcgcatgagatttttcacgctggcggaggtaaa
ggtgccaaccaagcagtggcagccaaacgttcaggcgcacggacatcttttattggaggc
gttggggctgacagcgaaggacaacagttattagatctactgacaaaagaaaacatcgat
acatctgggatagctgaaatccaaggcgccacaaccggacaagcaatgattatggtagac
gcagcaggagaaaatagtatcttgatccatgcaggggcaaataatgctttccatgaacaa
gaagtcctaaaaaacaagcaactgattacaaacagtgactttattattgctcagtttgaa
agtagcttagatgcgacgatcctagctttttctattgcaaaagacgcaggaaaaacaacg
atcctgaatcctgcaccagctcgtgaaacgattcctactgaactacttgaaaagacagat
atcattataccaaatgaaacagaaacagaaatcattacaggaatcagagtgacagatcat
aacagtttggtcgcagcagccgaaaaactccatgaattaggtattggaacagtaatcatt
acactaggcagtgccggcgctttctatcatacagaaaaagaacacggtatcgtccctgct
tttaaagtggatgccgttgacacaacagccgcaggtgatacatttattggcgcattaagc
agcacacttcagccagaccttagtaacttgaaagaagcgatcctttatggaaatctagcc
tcttctgttgctgtgcagtcttatggtgcgcaaccttctatcccttaccgcgaagcttta
gaacaatcagcagtctaa

DBGET integrated database retrieval system