KEGG   Enterococcus faecium Aus0004: EFAU004_00461Help
Entry
EFAU004_00461     CDS       T01772                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:efc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:efc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(476819..477289)
Genome map
AA seq 156 aa AA seqDB search
MSIYNFETTLEDGTVYSLKKYAGKPIIIVNTATKCGLAPQFKQLEELYQAYQTQGLVILG
FPSNQFKQELDSATEAAEACKTTYGVTFPMHQLIDVNGENTDPLFTYLKNEAPGTVTKAI
KWNFTKFLIDRNGKVIERFAPQTSPLKMTAAIESVL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttataattttgaaactactttagaagacggcactgtctattcattgaaaaaa
tatgcaggcaaaccgataatcattgttaacactgcaacaaaatgcggtctagcacctcaa
tttaaacaattagaagaactttaccaagcttatcagacacaaggtctggttatcttaggc
tttccttccaatcaatttaaacaagagctagattcagcgactgaagcagcagaagcttgt
aaaaccacttatggcgttaccttccctatgcatcaattgattgacgtaaatggagaaaat
acagatcctctttttacttatcttaaaaatgaagctcctggtactgtcactaaagcaata
aaatggaattttactaaatttttgattgatagaaatggcaaagtaatcgaacgatttgca
ccacaaacttctccattgaaaatgaccgctgcaattgaatccgttctttaa

DBGET integrated database retrieval system