KEGG   Enterococcus faecium Aus0004: EFAU004_00574Help
Entry
EFAU004_00574     CDS       T01772                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFAU004_00574
Enzymes [BR:efc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EFAU004_00574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
594536..595945
Genome map
AA seq 469 aa AA seqDB search
MQYKQLSAFPEKFLWGASISAYQAEGAYQEDGKQPSIIDKYQHTEGVANFEVASDFYHHY
KEDIQLFKELGLKAFRFSIAWTRIMDIENNKTNQKGISFYHQVIDECLNQGIEPIVTMYH
FDLPYFLEEQGGWLNRATIDYFVDYVQVLLTEYGDKVNYWLTINEQNTMILHPGAIGLPP
SGELPSKKELFQINHHVLLAQARVIHLYHQLNLKGKIGPAINLTAMYQATSSPEDAIAAH
NWETLRGWSFLDVAVRGKYNYLFENYLNDRGLYPKIEAEDQAILSSGKPDFIAINYYSTA
TIAASKNDGSDVSARAGDQQIMLGEEGVYRAAENPYVDKTPYGWVVDPTGLRLTLRKLYD
RYDLPILITENGYGAPDIVEEDRRINDQDRIDYLAKHILAIQAALTDGVDVFGYLPWSAI
DVVSTHQGFNKRYGFIYVDRTDENLKELKRIKKESFFWYQKVIARNGLA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatacaaacagctttcagcatttccagagaagtttttatggggtgcctccattagt
gcctaccaggcagagggtgcctatcaggaggatgggaaacaaccgtctattattgacaag
tatcagcatacagaaggggtagctaattttgaagttgcctcggatttttaccatcactat
aaagaagatatacagctgtttaaagaattaggcttaaaagcttttcgcttttccatcgct
tggacgcgaattatggatattgaaaataataaaaccaatcaaaagggaatttctttttat
catcaagtaattgatgaatgcctgaatcagggaatcgaaccgattgtcaccatgtaccat
ttcgatttaccttattttctagaggagcagggcggttggttaaatcgagcaactatcgat
tattttgtggactatgtacaggtattgcttactgagtatggtgacaaggtgaactattgg
ctgacaattaatgagcaaaacacgatgatccttcatcctggagcgattggtttgccacca
agtggagagctgccttcaaaaaaagaactctttcaaattaatcaccatgttttattagct
caagctagagtaattcacttgtatcatcagttgaatcttaaaggaaaaatcggtccagca
atcaatttaacggctatgtatcaagctacctccagtccagaagatgcaattgcagcccat
aattgggaaacattgagaggctggtctttcttagatgtagcagttcggggaaaatacaat
tatttgtttgaaaactatttgaatgatcgtggattatatcctaaaattgaggcagaggat
caggcaattttatcctccggtaaacccgattttattgcgattaattattattcaactgcc
accatcgctgccagcaaaaatgacggatcagatgtttccgctagagcgggggatcaacag
atcatgttgggagaagaaggtgtctaccgggcagctgaaaatccttatgtagataaaacg
ccatatggctgggtagttgaccctactggactacgattaacattgaggaaattgtacgat
cgctatgatttacctattttaattactgaaaatggctatggggcacccgacatagttgag
gaagatagacgaattaatgaccaggatcgaattgattatctagccaaacatattctggct
attcaagcagctttaacagatggtgtagatgtttttggttatttaccttggtcagcgatt
gatgttgttagtacccatcaaggcttcaataagcgttatggttttatatatgttgaccga
accgatgagaatcttaaagaattaaaacgaataaaaaaagaaagcttcttttggtatcaa
aaagtaatcgcaagaaatggcttagcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system