KEGG   Enterococcus faecium Aus0004: EFAU004_00712Help
Entry
EFAU004_00712     CDS       T01772                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
efc  Enterococcus faecium Aus0004
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EFAU004_00712 (recR)
DNA repair and recombination proteins [BR:efc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EFAU004_00712 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
745577..746173
Genome map
AA seq 198 aa AA seqDB search
MQYPEPIAKLIDSYMKLPGIGQKTATRLAFYTIDMKDEVVNEFAKSLLSVKRDLHFCSIC
GNITEEDPCEICRNPSRDRSVILVVEEPKDVMAMEKMREYHGLYHVLHGVLSPMEGTGPE
DINISSLLQRLHDADVKEVIIATNATTEGEATAMYLSRLIKPAGIKVTRLAHGLSVGSDI
EYADEVTLLKAVEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatccagaaccaattgcgaaactgatcgacagctacatgaaacttccaggaatc
ggtcagaaaacagcgacaagactcgccttttatacgatcgatatgaaagatgaagtagta
aatgaatttgctaaatctttgttaagtgtaaaacgcgatttgcatttttgtagtatctgc
ggaaacatcacagaagaagatccctgcgaaatatgtagaaatccttcacgtgatcgaagc
gttatcctagtggtcgaagagccgaaagatgtaatggcaatggaaaaaatgcgagaatat
cacggactttatcatgttctccatggtgtgttatcaccgatggaagggacaggtccagaa
gacatcaatatttcttctctgttgcagcggctgcatgatgcagatgtaaaagaagtgatt
atcgcaacaaatgcaacaacagagggagaagcaacagctatgtatctctcacgtctgatc
aaacccgcaggtatcaaagtgactcgtctagcacatggtctgtctgtaggctctgatatc
gagtatgcagatgaagttactttattgaaagctgtcgaaggaagacgtgagttataa

DBGET integrated database retrieval system