KEGG   Enterococcus faecium Aus0004: EFAU004_01092Help
Entry
EFAU004_01092     CDS       T01772                                 

Definition
(GenBank) dihydrolipoamide S-succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
efc  Enterococcus faecium Aus0004
Pathway
efc00010  Glycolysis / Gluconeogenesis
efc00020  Citrate cycle (TCA cycle)
efc00620  Pyruvate metabolism
efc01100  Metabolic pathways
efc01110  Biosynthesis of secondary metabolites
efc01120  Microbial metabolism in diverse environments
efc01130  Biosynthesis of antibiotics
efc01200  Carbon metabolism
Module
efc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFAU004_01092
   00020 Citrate cycle (TCA cycle)
    EFAU004_01092
   00620 Pyruvate metabolism
    EFAU004_01092
Enzymes [BR:efc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EFAU004_01092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AFC63177
Position
complement(1115114..1116757)
Genome map
AA seq 547 aa AA seqDB search
MAYQFKLPDIGEGIAEGEIVKWFVKPGDTINEDDTLLEVQNDKSVEEIPSPVTGTVKNVI
VPEGTVANVGDVLVEIDAPGHEDNEGDSGVAAESQTPAKPAAEPTVDTESAGSSSEGVFQ
FKLPDIGEGIAEGEIVKWFVKPGDTINEDDTLLEVQNDKSVEEIPSPVTGTVKNVIVPEG
TVANVGDVLVEIDAPGHNSAPSTSAPSAEAPKEKVETSGSASVVEAADPNKRVLAMPSVR
QFAREKDVDISQVTATGKGGRVTKEDIENFLAGGPSSAPAKSEAPEAAAPKEAAPAAESK
PAAPAKPFKSNLGDLEERVAMTPTRKAIAKAMVNSKHTAPHVTLHDEVEVSKLWDNRKRF
KEVAAANGTKLTFLPYVVKALTATVKKYPVLNASIDDANQEIVYKHYYNIGIATDTDHGL
YVPNVKDADRKGMFAIADEINEKAKLAHDGKLSAEDMRNGTITISNIGSVGGGWFTPVIN
YPEVAILGVGTIAQQPIVNAEGEIVVGRVMKLSLSFDHRIVDGATAQQAMNNIKRLLADP
ELLMMEG
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaatttaaattgccggatatcggtgaaggaatcgcagaaggtgaaatcgtc
aaatggttcgtcaaaccaggagatacgatcaatgaagatgatacattactagaagttcaa
aatgacaaatcagtagaagaaatcccgtcacctgttacaggaacggttaaaaatgtgatt
gttccagaaggtaccgtagcaaatgttggggatgtattagtagaaatcgatgcaccagga
cacgaagacaatgaaggggacagtggtgtagccgcagaatcccaaactccagctaaaccg
gctgctgaacccactgttgatacagaatcagctggatcgtcaagcgaaggagtcttccaa
tttaagttaccggatatcggtgaaggaatcgcagaaggtgaaatcgtcaaatggttcgtc
aaaccaggagatacgatcaatgaagatgatacattactagaagttcaaaatgacaaatca
gtagaagaaattccgtcacctgtcacagggacagttaaaaacgtgattgttccagaaggc
actgtagcaaatgttggggatgtattagtagaaatcgatgctcctggacacaatagtgca
ccgtcaactagtgcgccatcagctgaagcaccaaaagaaaaagtggaaacatcaggttca
gcaagtgtcgttgaagctgccgatccaaataaacgtgtattggctatgccatctgttcgt
caatttgcccgtgaaaaagatgtagatatctcacaagtaactgcaactggaaaaggtggc
agagtaacaaaagaggacatcgaaaacttcttggcaggtggtccaagcagtgcaccagcg
aaatcagaagcgccagaagcggcagcaccgaaagaagcagctcctgcagcagaaagcaaa
ccagctgcaccagcaaaaccattcaagtccaacttaggagacttggaagaacgtgtagca
atgacgccaacacgtaaagctatcgctaaagcaatggtcaacagtaagcatacagctcca
cacgtgacattgcatgatgaagtagaagtgtctaaactatgggataatcggaaacgattt
aaagaagttgctgctgcaaatggtacgaaacttactttcttgccatatgtcgtgaaagct
ttaacagcgactgttaagaaatacccagtattgaatgcatctatcgacgatgcaaaccaa
gaaatcgtttataaacattactacaatatcggtattgcaactgatacggatcacggacta
tatgtaccaaatgtgaaagatgcagaccgcaaaggaatgtttgctattgcagacgaaatc
aatgagaaagcaaaattagctcatgacggcaaactatctgcagaagatatgcgcaatgga
acaattacgatcagcaatatcggatctgtaggtggcggttggtttacaccagtcatcaac
tatccagaagtagctattttaggtgtaggaacgattgcacaacaaccaatcgtaaatgct
gaaggcgaaatcgttgtcggtcgtgtgatgaaactgtcattaagtttcgatcaccgtatc
gtagatggagcaactgcgcaacaagcaatgaataatatcaaacgtcttttagctgatcca
gagctattaatgatggaaggatga

DBGET integrated database retrieval system