KEGG   Enterococcus faecium Aus0004: EFAU004_01292Help
Entry
EFAU004_01292     CDS       T01772                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EFAU004_01292 (pfkA)
   01230 Biosynthesis of amino acids
    EFAU004_01292 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFAU004_01292 (pfkA)
   00030 Pentose phosphate pathway
    EFAU004_01292 (pfkA)
   00051 Fructose and mannose metabolism
    EFAU004_01292 (pfkA)
   00052 Galactose metabolism
    EFAU004_01292 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EFAU004_01292 (pfkA)
Enzymes [BR:efc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EFAU004_01292 (pfkA)
Protein phosphatases and associated proteins [BR:efc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EFAU004_01292 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1333821..1334783)
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVVRKGIYEGLEVYGINYGFAGLVAGDIRRLDVADVGDK
IQRGGTFLYSARYPEFATEEGQLKGIEQLKKFGIEGLVVIGGDGSYHGAMALTKRGFPAV
GIPGTIDNDIPGTDFTIGFDTAINTVLESIDRIRDTATSHVRTFVIEVMGRNAGDIALWS
GVAGGADEIIIPEHDFDMASVAKKIQEGRDRGKKHCLIILAEGVMGGNEFAEKLSEFGDY
HTRVSILGHVVRGGAPSARDRVLASKFGAYAVELLQEGKGGLCVGIHDNEIVASDIIDTL
ENNKHKPDLSLYDLNNSLSF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcggaattttgaccagtggcggagacgcacctggaatgaatgcagctgtt
cgtgccgttgttcgtaaaggtatttacgaaggactggaagtatacgggatcaattatggt
tttgccggtttagttgctggagatattcgtcgtcttgatgtggcagatgtaggtgacaag
atccaacgtggtggtacattcttgtattctgcacgttatccagaatttgcaactgaagaa
ggtcaattaaaaggaatcgaacaattgaaaaaattcggaatcgaaggtctagtggttatc
ggaggagacggctcttatcatggcgcaatggctttgacaaaacgcggtttcccagcagta
ggtattcctggaacaatcgataatgatattcctgggactgatttcacaatcggttttgat
acagcaatcaatacagtactagaatcaattgaccgtattcgtgacacagcgacttctcat
gttcgtacattcgttatcgaagtaatgggacgcaatgcaggagacatcgctttatggtca
ggtgtggctggcggagcggatgaaatcatcatcccagaacatgattttgatatggcttca
gttgctaaaaaaatccaagaaggccgcgatcgcgggaagaaacattgcttgatcatcttg
gctgaaggtgtaatgggcggaaatgaattcgctgagaaactttcagaatttggtgactat
catacacgtgtatctatcttgggacacgttgtccgtggtggagcaccaagcgcacgcgac
cgcgtgttggcaagtaaattcggtgcttacgctgtcgaattgcttcaagaaggaaaaggt
ggattatgtgtcggtatccatgacaacgaaatcgttgcgtctgacatcattgatacactt
gaaaacaacaaacataaaccagacttatcactatatgatctaaataattcactttcattt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system