KEGG   Enterococcus faecium Aus0004: EFAU004_01585Help
Entry
EFAU004_01585     CDS       T01772                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EFAU004_01585
  Lipid metabolism
   00561 Glycerolipid metabolism
    EFAU004_01585
   00600 Sphingolipid metabolism
    EFAU004_01585
Enzymes [BR:efc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     EFAU004_01585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1601829..1604054)
Genome map
AA seq 741 aa AA seqDB search
MDITHRKTDKNFILFDEKSRVFHLRNTFLSYLIKIEESNVLAHIYFGKPVKQYKDNKNYP
RRDRGFSGNVPLNPDRSLSKDTLPQEYSSHGSMDFRTPASIIQRKNGSDLLDLRYDSHYI
TDGKPEIEGLPQTYVMDKSEAQTLVISLKDRETAIYFDLFYTIFTDRAVITRSVKIRNET
GETIKLEKAASFQLDFAHTRRFDEVIALPGAHVNERQISRQSVLSGTKVFESRRGTSSHH
MNNFIALVHHHTTENTGEAIGLQFVYSGNHSFELEKDQINQLRVVGGINSHRFSWELNAG
QSFQTPEMILSYSSQGLNKMSQIHHELLRERIARGRHQFAERPILVNNWEATYFDFNSEK
IKAIIDEAKELGIEMFVLDDGWFGKRDADNSSLGDWFEYEGKLTNGLREIADYAHSKGLK
FGLWFEPEMISVDSELYRTHPDFLMQEPGRMPSASRSQHVLDFTRLDVRQTIEKQMRKIL
DTIPLDYIKWDMNRSLSDVYSITLDPQRQGEVAHRYMLGLYELLEHLTTDYPEILWEGCS
GGGGRFDAGFIYYMPQSWTSDNTDAVERMKIQYGTSLAYPISSITAHVSAVPNHQTDRST
SLKTRGETAMSAVFGYELDLTKLSPEEKKQVKDQIISYQTIRPVIQYGHYYRLASPFEEN
IAAWMFVSPKQDEAIVFLGRILASAQPAFHEVYLMGLDDEALYQEQTSKRIFSGAELMTV
GLYFPDFQGDFQTELLHFKKL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggatattacgcatagaaaaacagataaaaatttcatcttatttgatgaaaagagccga
gtcttccatttacgaaatacatttctttcttatctgataaagatagaagaaagcaatgta
ttggcgcatatttattttggcaaaccagtcaagcagtacaaagacaataaaaattatccc
cgaagagatcgtggattttcaggaaatgttcccttaaatcctgaccggtctctgtcgaaa
gatacactaccgcaagaatactcttctcatggcagcatggactttcgaacgcccgcatcg
atcattcagcgcaagaatggatcagacttactggatctgagatatgacagccattatatt
acagatgggaagccagagatcgaaggcttgcctcaaacttatgtgatggacaagtcagag
gcacaaacgttggtgatttcacttaaggatagagaaacagcgatttatttcgatttgttc
tataccatatttactgatagagcagtgatcacacgatctgtaaagataagaaatgaaacc
ggagaaacaatcaaactagaaaaagcggctagtttccagctagactttgcccatactagg
cgatttgatgaagtcattgctttgccaggagcacatgtcaatgaaagacagatttcacgg
caatctgttttatctggaacaaaagtatttgaaagccgtcgaggaacgagcagtcaccat
atgaataactttattgctttagttcatcatcatacgacagaaaatactggagaagcgatc
ggacttcaatttgtttattccggcaaccattctttcgaacttgaaaaagatcagatcaat
caattgagagtcgtcggtgggatcaacagccatcgtttttcgtgggaattgaatgcaggc
cagtcttttcaaacacctgaaatgatcctttcttactcaagtcagggattgaacaaaatg
agtcagatccaccatgagttgctacgtgaaagaatcgcaagaggtcgtcatcaatttgct
gaacggccgattctggtcaataactgggaagccacttactttgacttcaatagtgaaaaa
atcaaggcgatcattgatgaagcaaaggagctaggcatcgaaatgttcgtattagatgat
ggctggtttggaaaaagagatgcggacaattcttcattaggagactggttcgagtatgaa
ggcaagttgacaaatggattacgtgaaatagcagattatgctcatagcaaaggattgaaa
tttggtttatggtttgaacctgaaatgatctcggttgattctgaactgtatcgaacacat
cctgattttcttatgcaggagccaggtagaatgccttctgcttccagatcacaacatgta
ctggattttacaaggttagatgttcggcagacgattgagaaacaaatgagaaagatttta
gatacgattcctcttgactacatcaaatgggatatgaaccgttcgctttcagatgtctat
tcgattacccttgacccacagagacaaggagaagtagcgcatcgttatatgctcgggctt
tatgaactacttgaacatttgacaactgattatccggaaatcttatgggaaggctgttct
ggtggaggtggacggtttgatgccgggtttatttattatatgccgcagtcatggacaagt
gataacacggatgcagtggagcgtatgaaaatccaatatggaacaagccttgcttatccg
atttcgtccatcacagctcatgtatcagctgtaccaaatcatcagaccgacagatctact
tcgttgaaaacaagaggagaaacagctatgagcgctgtttttggttatgaactggatttg
acaaagctgtctcctgaagaaaaaaagcaagtaaaagaccaaattatatcctatcaaacg
attcgtccggtgatccagtatggccattattatcgtttggcgagtccttttgaagaaaat
attgccgcatggatgtttgtgtctcctaaacaagatgaagctattgtgtttttagggagg
atactagcttcagctcaaccagcgttccatgaagtatatctgatggggttagatgatgag
gcactttatcaggaacagacctcgaagcggatattttcgggggccgaattgatgacagtt
ggactttacttccccgattttcaaggtgatttccaaacagaactgcttcatttcaaaaag
ttatga

DBGET integrated database retrieval system