KEGG   Enterococcus faecium Aus0004: EFAU004_01757Help
Entry
EFAU004_01757     CDS       T01772                                 

Gene name
dfrD
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
efc  Enterococcus faecium Aus0004
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EFAU004_01757 (dfrD)
   00670 One carbon pool by folate
    EFAU004_01757 (dfrD)
Enzymes [BR:efc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EFAU004_01757 (dfrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1783235..1783753)
Genome map
AA seq 172 aa AA seqDB search
MFISMWAQDKNGLIGKNGLLPWRLPNDMRFFREHTMDRILVMGRKTYEGMGDLSLPYRHI
IVLTTQPNFRTKENAEVMHSIDELLSYSQTISEDIYVSGGSRIFQELLPYTGRIWRTLID
STFEGDTYIGNIDFSDFALIEEYEGITDQENLYAHRFQKWERVKNRVASKEE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtttatttccatgtgggcacaagataaaaatggtctgatcggcaaaaatggtttgtta
ccatggcgattgccaaatgatatgcgtttctttcgcgaacatacaatggatcgaatttta
gtgatgggaagaaagacctatgaaggaatgggggatctttcacttccttatcgccatatc
atcgtgttgacaacgcaaccaaattttcgcacgaaagaaaatgcggaagtaatgcattcg
atcgatgaacttttgtcgtatagtcaaacgatctcagaagatatctatgtttcgggtggt
agtcggatttttcaagaacttcttccttacactggtcggatctggcgaacattgatcgat
agcacgtttgaaggcgatacgtatattgggaatattgatttttcagacttcgcccttata
gaggagtatgaggggataacggatcaagaaaatctatatgcccatcgttttcaaaaatgg
gaaagagtaaaaaatagggttgcttcaaaagaagaataa

DBGET integrated database retrieval system