KEGG   Enterococcus faecium Aus0004: EFAU004_02021Help
Entry
EFAU004_02021     CDS       T01772                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
efc  Enterococcus faecium Aus0004
Pathway
efc00040  Pentose and glucuronate interconversions
efc00052  Galactose metabolism
efc00500  Starch and sucrose metabolism
efc00520  Amino sugar and nucleotide sugar metabolism
efc01100  Metabolic pathways
efc01130  Biosynthesis of antibiotics
Module
efc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EFAU004_02021
   00052 Galactose metabolism
    EFAU004_02021
   00500 Starch and sucrose metabolism
    EFAU004_02021
   00520 Amino sugar and nucleotide sugar metabolism
    EFAU004_02021
Enzymes [BR:efc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EFAU004_02021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AFC64105
Position
complement(2050816..2051754)
Genome map
AA seq 312 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALKSGIEDILIVTGKAK
RPIEDHFDSNIELETNLSEKGKTELLKLVEETTDVNLHFIRQSHPKGLGHAVLQARAFIG
NEPFVVMLGDDIMEDEVPLTQQLIDDYERTHASTIAVMQVPHDETSKYGIINPGEVLEDG
LYNVKNFVEKPDPSKAPSDLAIIGRYLLTPEIFDVLSEQQPGAGNEIQLTDAIDTLNKTQ
RVFARKFTGKRYDVGDKFGFMKTSIEYGLTHPEVGAPLREYILSLGKTLEAEGSKIDHNP
KGITEIKEEKKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaagcagttattccagcagcaggattaggaacaagatttttaccagca
acaaaagctatggcaaaggaaatgttgccaattgttgataaaccaacaatccagttcatc
gttgaagaagcgttgaaatcaggtatcgaagacatcttgatcgttacaggaaaagctaaa
cgaccaatcgaagatcactttgattcaaatattgaattagaaacaaacctaagtgaaaaa
ggaaagaccgaattattgaaattagtagaagaaacgacagatgtcaacttgcatttcatc
cgtcaatctcatccaaagggtttaggacatgccgttcttcaagcaagagcctttattgga
aatgaaccatttgtcgttatgctaggcgatgatataatggaagacgaagtaccattgaca
cagcaattaatcgatgattacgaacgtactcatgcttctacgatcgccgttatgcaagtt
cctcatgatgaaacttcaaaatacggaattatcaatccaggagaagtattggaagatggg
ttatacaatgtcaaaaactttgttgaaaaaccagatccaagcaaagcaccaagtgattta
gctattattggacgttacttattgactccagaaatttttgatgtattgtccgagcaacaa
ccaggagccggaaatgaaatccaactaactgacgcaatcgatacattgaataaaacacaa
cgcgtatttgcccgtaaattcacaggtaaacgttacgatgtcggtgacaaatttggtttt
atgaaaacaagtattgaatatggtctaacacatccagaagtaggtgcacctttacgtgag
tacatcctgtctttaggtaaaacattagaagcagaaggaagcaagatcgatcataatcca
aaaggaataacagaaatcaaagaagaaaagaaaaaataa

DBGET integrated database retrieval system