KEGG   Enterococcus faecium Aus0004: EFAU004_02066Help
Entry
EFAU004_02066     CDS       T01772                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
efc  Enterococcus faecium Aus0004
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2092234..2092989)
Genome map
AA seq 251 aa AA seqDB search
MRRVRQLPKPLYAKHGKRAVLLLHAYSGSPNDVRMLARFLEKADYTVYAPLFKGHGTMEP
YDILQEKAESWWADTKKAIHFLQSEQFSDIAVLGLSMGGIFAVRALEEESVIGGGFFCSP
LSPVKTNVPENFEKYVRQVLKTAGKSEKEINEKAVAYRSLAEQQLMDIQDQAAIVESRLS
DIQQPIFLAQAGKDEMIDPNGVFETARKLSRQRVTLRWYPESGHVITVGTARRELEKDVL
EFLEKLPWNEE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgagacgagtgagacaattaccaaaacccctttatgcaaaacatggaaagcgagcggtt
ttgctgcttcacgcttactcaggaagtccaaacgatgttcgaatgctcgcacgatttttg
gaaaaagcagattatacagtttatgcgccgctttttaaaggacacggaacaatggagcca
tatgatattttgcaagaaaaagcagaaagctggtgggcagacactaaaaaagccatccat
tttttacagtctgagcagttttctgatattgccgtattaggattatcaatgggcggcatc
tttgctgtacgagcactagaagaagaatcagtgattggcggcggttttttctgttcgcct
ttgtctcctgtaaaaacaaacgtgcctgaaaactttgaaaaatacgtacgtcaagtgctg
aagacagcaggtaaatcagagaaagaaatcaatgaaaaagcagttgcttaccgctcgtta
gctgaacaacaattaatggatatacaagatcaggcagcaatcgtagaaagtaggttgtca
gatatccaacagccgatatttttagctcaagctgggaaagatgaaatgatcgaccctaat
ggcgtatttgaaactgcacgcaagttgagccgtcagcgagtgacacttcgatggtatcct
gaaagtggtcatgtgattacagttggtacagcaagacgcgaattagaaaaagacgtcttg
gaatttttagaaaaattaccttggaatgaggaataa

DBGET integrated database retrieval system