KEGG   Enterococcus faecium Aus0004: EFAU004_02074Help
Entry
EFAU004_02074     CDS       T01772                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
efc  Enterococcus faecium Aus0004
Pathway
efc00010  Glycolysis / Gluconeogenesis
efc00051  Fructose and mannose metabolism
efc00562  Inositol phosphate metabolism
efc01100  Metabolic pathways
efc01110  Biosynthesis of secondary metabolites
efc01120  Microbial metabolism in diverse environments
efc01130  Biosynthesis of antibiotics
efc01200  Carbon metabolism
efc01230  Biosynthesis of amino acids
Module
efc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
efc_M00002  Glycolysis, core module involving three-carbon compounds
efc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFAU004_02074 (tpiA)
   00051 Fructose and mannose metabolism
    EFAU004_02074 (tpiA)
   00562 Inositol phosphate metabolism
    EFAU004_02074 (tpiA)
Enzymes [BR:efc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EFAU004_02074 (tpiA)
Exosome [BR:efc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EFAU004_02074 (tpiA)
  Exosomal proteins of bladder cancer cells
   EFAU004_02074 (tpiA)
  Exosomal proteins of melanoma cells
   EFAU004_02074 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFC64158
Position
complement(2099662..2100417)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTASEAKEFAEAVKNKIPSNDKVDSVIGSPALFLQELMTSAEGTELK
ISAQNCYWENSGAFTGETSPAALADLGVHYVIIGHSERREYFHETDEDINKKAKAIFANG
MTPILCCGESLETYEAGKTAEWIEGQITAGLADLSAEQVSNMVIAYEPIWAIGTGKSADA
QIADEICGVVRQTVEKLYGKEVSEAVRIQYGGSVKPENIAEYMAKENVDGALVGGASLQA
DSFLSLLDAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacctattatcgcaggtaactggaaaatgaacaaaactgcatcagaagcaaaa
gaatttgctgaagcagtaaaaaacaaaatcccttcaaatgacaaagttgattcagtcatc
ggatctcctgcattattcttacaagaattaatgacatcagctgaaggtacagaactaaaa
atctcagcacaaaactgctactgggaaaactcaggtgcgttcactggtgaaacttcacca
gcagctcttgctgatctaggtgttcattatgtgatcatcggacattcagaacgtcgtgaa
tatttccatgaaacagacgaagacatcaataaaaaagcgaaagctatctttgcaaatggt
atgacaccaatcctatgctgtggcgaatctttagaaacctatgaagcaggcaaaactgct
gaatggatcgaaggacaaattacagctggtttagctgatctttcagctgaacaagtgtca
aacatggttattgcttatgaaccaatctgggcaatcggtactggtaaatcagctgacgca
caaatcgctgacgaaatttgtggagttgtacgtcaaacagttgaaaaactttatggaaaa
gaagtatcagaagcagttcgtatccaatacggcggttctgtaaaaccagaaaatattgct
gaatacatggcaaaagaaaatgttgacggtgctttagtcggtggcgcaagcttgcaagca
gattcattcttgtcattgttagacgctgtaaaataa

DBGET integrated database retrieval system