KEGG   Enterococcus faecium Aus0004: EFAU004_02103Help
Entry
EFAU004_02103     CDS       T01772                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
efc  Enterococcus faecium Aus0004
Pathway
efc00010  Glycolysis / Gluconeogenesis
efc00030  Pentose phosphate pathway
efc00051  Fructose and mannose metabolism
efc00680  Methane metabolism
efc01100  Metabolic pathways
efc01110  Biosynthesis of secondary metabolites
efc01120  Microbial metabolism in diverse environments
efc01130  Biosynthesis of antibiotics
efc01200  Carbon metabolism
Module
efc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFAU004_02103
   00030 Pentose phosphate pathway
    EFAU004_02103
   00051 Fructose and mannose metabolism
    EFAU004_02103
  Energy metabolism
   00680 Methane metabolism
    EFAU004_02103
Enzymes [BR:efc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     EFAU004_02103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos Metallophos_2 DUF1402
Motif
Other DBs
NCBI-ProteinID: AFC64187
Position
complement(2128507..2130405)
Genome map
AA seq 632 aa AA seqDB search
MDRYLDLLSEKFPTTEDVITEIINLEAILQLPKGTELFLSDIHGEFPAFDHILRIGSGNL
KEKIKDLFSEQMTETEISQFTIFTAYPEYVLTTDWYKKQDKSQLIHRLIDLLRFTTVKYT
RSKVRKGLPKEYSYIIEELLYIDDRINGKKDYVKKIIEQLVLMKEEEKFLTKLAQTIQKS
VIDHLHIVGDIFDRGTQAAKVMDRIMDFSSVDIQWGNHDILWIGAYCGSEACLLTLLRIA
ARYNYLFELEKEYGLNLRPLFSFAHQTYQKNPVFTPKNRKDLSEREQEELEKIHQALSIL
QFKSEHQLLNRRPEFKMDDRKLLEKINYEESTIVLEGQLYELKGTCFQTIQPDDPKKFLE
EEQKVIDSLMYSFQHSLRMQKHMTFLIEKGGMYLTNNQHVLFHGCIPVDEKGQLLAFELD
QSYRGKELLGFFEKQITESAKDLTANEDLATDLIWYAWSGPFSPLFGKSKMATFERYFLT
EPHTHVEKSNPYYHLRDEEWFSEKILAEFDAKEEGSAIINGHTPVKVKKGESPIKANGKA
FVIDGGLSKAYQKTTGIAGYSLLCNSYGFQIVTHYPFLPIEQQFAKKSDQTNVKKVIEQQ
LPRKLNRNTTKGMELQQQITQLQRLLDYRKDD
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggaccgctatttagatttactttcagagaagttccctacaacggaagatgtcatcacg
gaaatcatcaatctcgaagcaattttgcagcttccaaaaggaacagagttatttttgagc
gatatacatggcgaatttcctgcttttgatcatattctgcgtatcggttcaggaaatctt
aaagaaaagatcaaagaccttttctctgaacaaatgacggaaacggagatcagccaattc
actatttttacggcttatccagaatatgtgttgacgactgattggtacaaaaaacaagat
aaatcccagctgatccatcgtttgatcgatcttttacggtttacgacagtcaaatacact
cgatcaaaagttcgaaaaggattgccgaaagaatatagctatatcattgaggaactcttg
tatatcgatgatcgtatcaacgggaaaaaagactatgtaaaaaaaatcattgaacaactt
gtcttgatgaaggaagaagaaaaatttttaacaaaacttgcgcagacgatccaaaaatct
gtcatcgatcatttgcatatcgtgggtgatatttttgatcgaggaactcaagcagccaaa
gtaatggatcgaatcatggatttttcctctgtagatatccagtgggggaatcatgatatt
ttgtggattggtgcgtattgcggctctgaggcatgtttattgacgcttttacggattgcc
gcacgctacaactatttatttgaattagagaaagaatatggattaaatttacgtccatta
ttttcttttgcccatcaaacctatcagaagaatccagtatttacccctaaaaacaggaaa
gatctatctgaaagagagcaagaagaattagaaaagatccatcaagcactttctatcctc
caattcaaatcagaacatcagttgttgaatcgacgacctgaatttaaaatggacgatcgt
aaattgttggaaaaaatcaactatgaggaatcaacgatcgttttagaaggtcagctctat
gagttgaaagggacttgttttcaaacgatccagccagatgatcctaaaaaattcttggaa
gaggaacaaaaagtgatcgatagtttgatgtattcattccagcactcgttaagaatgcaa
aaacacatgacgtttttgatcgaaaaagggggaatgtatctcacgaacaatcagcatgta
ctgttccatggctgtatacctgtagatgaaaaggggcagctcttagcatttgaattagac
caatcttatcgcggaaaagaactgctgggattttttgaaaaacagataactgaaagcgca
aaagatttgactgcaaatgaagatttggcgaccgatttgatttggtatgcgtggagcggg
ccattttcgcctttattcggcaagagtaaaatggcaacttttgagcgctattttctcaca
gagcctcatacgcacgtcgaaaaaagcaatccctattatcacttgcgagatgaagagtgg
ttcagtgaaaaaattttggcagaattcgatgcaaaagaagaaggttcagcaatcatcaat
ggacacacgccagtaaaagtaaaaaaaggagagtcaccgatcaaagcaaacggaaaagca
tttgttattgacggaggtctatccaaagcttatcaaaaaacaaccgggattgctggctac
tcattactatgcaattcttacggtttccaaatcgtgacacattatccgttcttgcctatt
gaacaacaatttgcaaaaaaatctgatcaaacgaatgtaaaaaaagtgatcgagcagcag
ctcccacgcaaacttaatcggaatacgacaaaaggaatggaattacagcaacagattact
caactccaaaggctgttggattatcgaaaggacgattga

DBGET integrated database retrieval system