KEGG   Enterococcus faecium Aus0004: EFAU004_02287Help
Entry
EFAU004_02287     CDS       T01772                                 

Gene name
lacG
Definition
6-phospho-beta-galactosidase (EC:3.2.1.85)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFAU004_02287 (lacG)
Enzymes [BR:efc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EFAU004_02287 (lacG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2323968..2325404)
Genome map
AA seq 478 aa AA seqDB search
MEHKELTSFPKDFLWGSASAAYQVEGAWQEDGKGESVWDRFVRIPGKTFKGTNGDLAVDH
YHRYKEDIALMKEQGLKAYRFSVAWTRIFPNGRGEVNQAGLAFYERLIDELIENDIEPML
TLYHWDLPQALQDEYNGWESRQIIEDFTHYAETLFEAFRGKVHYWISLNEQNIFTSLGYL
LAAHPPGVTDPKRMYEVNHIANLANASVINKFHELEMPGKIGPSFAYTPNYPIDSNPENV
LAAENAEDLMANYWMDVYMWGKYPIAAMRFLEEKGWAPTIEAGDAELLESAKPDFLGINY
YQTATNAFNPLNGVGAGKMNTTGKKGSSEETGVPGMYKKVENPFVERTNWDWEIDPEGLR
IGLRRITSRYRMPVLITENGLGEYDKLTEDKQIHDDYRINYLQSHVKAIKEAISDGAEVL
GYCTWSYTDLLSWLNGYQKRYGFVYVDQDETQEGSLERYKKDSYYWYQKLIEENGENL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaaagaacttacctcatttccaaaagattttctgtggggctctgcttctgca
gcgtatcaagtagaaggagcttggcaagaagatgggaaaggagaatcagtctgggatcga
tttgtacggatacctggaaagacatttaaaggaacgaacggtgatttggcagtagaccac
tatcatcgttataaagaagatattgctttaatgaaagaacaaggtctgaaagcttaccgc
ttctctgtagcttggacacggatttttcctaatggacgaggagaagtcaatcaagctggg
ctcgctttttatgagagattgatcgacgaattgattgaaaacgatattgaacctatgttg
actttatatcattgggatcttccacaagcattgcaagatgaatataatggttgggaatca
cgtcagatcattgaagatttcactcattatgcagaaacattatttgaggcattccgcggg
aaagtccattactggattagtttgaatgaacaaaatatcttcacttcattaggttatttg
ttagcagcacatccgccaggtgtgacagacccgaaacgaatgtatgaagttaaccatatt
gctaatttagcaaatgcatctgtcatcaataaatttcacgagttagaaatgcctggaaaa
atcggaccaagctttgcgtatacgccaaattatccaattgacagtaatcctgaaaatgtt
ctggctgctgaaaatgcagaagacctgatggccaattattggatggatgtctatatgtgg
ggaaaatatccgattgctgccatgaggttcttagaagaaaaaggatgggcaccaacgatt
gaagctggcgatgcagaattgctagaatctgctaaaccagattttcttgggatcaattac
tatcaaacggcgacgaatgcattcaatccattaaacggagttggtgctggaaaaatgaat
acgacaggaaaaaaaggttcatcagaagaaactggagttcctggaatgtataaaaaagtt
gagaatccatttgtcgaacgaacaaattgggactgggagattgacccagaaggattaagg
atcggactgcgtcgtatcacaagccgttaccgcatgccggtactgattacggaaaatggc
ttaggagagtatgacaagttgacagaagataaacaaatccatgacgactatcgaatcaat
tacttacaaagccacgtcaaagccatcaaagaagcaatttcggatggagcagaagtccta
ggctattgcacctggtcttatacagatttgcttagctggctgaacggttatcaaaagcga
tatggatttgtatatgttgatcaagacgaaacacaagaaggatctttggaacgatataag
aaagacagttattactggtaccaaaaactgattgaagaaaatggagagaacctttag

DBGET integrated database retrieval system