KEGG   Enterococcus faecium Aus0004: EFAU004_02313Help
Entry
EFAU004_02313     CDS       T01772                                 

Definition
Mur ligase middle domain-containing protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    EFAU004_02313
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EFAU004_02313
Enzymes [BR:efc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     EFAU004_02313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2347552..2348904
Genome map
AA seq 450 aa AA seqDB search
MGIRSHFAIAVGKTSQWALKTFFKGGSSLPGKLALKVDPHILDSLAKDYQVVVVTGTNGK
TLTTALTVNILRQQFDEVLTNPTGANMVQGIVSTFLQAKPKKGQKKFAVLEIDEASLSKV
TEYMKPELFLFTNIFRDQMDRYGEIYTTYKMIVDGAAKSPNATIISNGDSPIFNSIETVN
PRKYYGFDHEEDREQMAHYNTDGVLCPNCHHILHYKMITYANLGKYYCPNCDFKRPELDY
RLTDMVRMDNVSADFVIDGHEYGIEVGGMYNVYNALAATAVAEYFNVDPDKIKQGLGYDE
KVFGRQEVININGKKCTLVLVKNPVGINQVIDMIGLAPYPFSLVALLNANYADGIDVSWI
WDGNFENFADMDIPAVISGGDRHTDMTLRLKVAGIPENKLTETKELPEVIEKIKELPTEH
VYILATYTAVLQLRKELAAQGFIKGGMNRG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgggaatacgcagtcattttgcgattgcagttggaaaaacgtcgcaatgggcattaaaa
actttttttaaaggcggatcaagtttaccaggtaaactagcgctgaaagtcgatccacat
atactagatagtttggcaaaagactaccaagtcgtcgttgtcaccggaacaaacggtaaa
acattgactaccgctttaacagtcaatattttgcgccagcaattcgatgaagttctaacc
aaccctactggtgcgaatatggtacagggaattgtatcgactttcttgcaggcaaaacca
aaaaaaggacagaaaaagtttgctgtcctagaaatagatgaagcaagtttgagcaaagtc
acagaatatatgaaaccagaactgttcttatttacaaatattttccgtgatcaaatggat
cggtatggagaaatctatacgacctataaaatgattgtagacggtgccgcaaagtcacca
aatgcaacgattatcagtaacggtgattcaccaatcttcaattctatcgaaacagtcaat
cctagaaaatattatggctttgaccatgaagaagatcgtgaacaaatggctcattacaat
acagacggtgtcttatgtccaaattgtcatcacatcttgcattataaaatgatcacttat
gcaaacttagggaaatattactgtccaaattgtgacttcaaacgtcctgaattggattat
cgattaactgatatggtacggatggacaatgtgtcagcagatttcgtgatcgatggtcat
gaatacggaatcgaagttggcggtatgtataatgtctacaatgctttagcagctactgca
gtggcagagtacttcaatgtcgatcctgataaaatcaaacaaggtttaggatatgacgag
aaagtattcggccgacaagaagtcatcaatatcaatgggaaaaaatgtacattagtactt
gtcaaaaatcctgtaggtatcaatcaagtaatcgatatgattggtctagctccttatcca
ttttctttagtggctttattaaatgccaattacgcagacggaatcgatgtcagctggatt
tgggatggtaattttgaaaactttgccgatatggatatcccagctgttatttctggagga
gaccgtcatacagatatgactttacgtctaaaagttgccgggattccagaaaataaattg
acagaaacaaaagaattaccagaagtaatcgaaaaaatcaaagaattgccaactgagcat
gtctatattttagctacttacactgctgtattgcagcttcgtaaagaactagctgctcaa
ggatttatcaaaggaggaatgaaccgtggctaa

DBGET integrated database retrieval system