KEGG   Enterococcus faecium Aus0004: EFAU004_02469Help
Entry
EFAU004_02469     CDS       T01772                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EFAU004_02469
Enzymes [BR:efc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EFAU004_02469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2485035..2487623)
Genome map
AA seq 862 aa AA seqDB search
MQPEEMPYFVGTVAAIFFQNPSNFYKVLLVHISETTADYREKEIVVTGSFGDIQENETYR
FYGELVDHPKYGRQLKLERYEQEKPTTANGIVAYLSSEKFPGIGKKTAEKIVELLGEDAI
EKIIADPSVLKQISGLTKPKREMLAETIRLNHGMDQVIMGLNRYGFGSQLAFSIYQAYKN
ESLDIIEENPYQLVEDIEGIGFKRADNLAEQIGIAADSPRRIRAAILHQIFQHAVQTGDT
YVPAETLLQQTIRILETSRPIEIQPDQVATVIIQLVEEGKIQQEETNLYENSLYFSEWGI
GNSIQRLLSRKKEIHYPEKEVQKNIRRIEKIFGIQYGPSQEQAIAEAIRSPLFILTGGPG
TGKTTVINGIVNLFAELNGLELDPSKYTQEIFPILLAAPTGRAAKRMNETTGLPASTIHR
LLGLNGREKTPSVSTKELEGGLLIVDEMSMVDTWLANTLFKAIPTNMQVILVGDKDQLPS
VGPGQVLHDLLEIEQIPKMELNQIYRQGDGSSIIPLAHEIKEGRLPKDFTKNQKDRSYFR
SDAYQIEPLISKIVEKAKNKGFRAQDIQVLAPMYRGPAGIDALNKMMQEIFNPGKPGKKE
VHWNDTVYRIGDKVLQLVNTPELNVFNGDMGEITGIILAKDSEDKVDELVIQFDANEVTY
KRNEWNKITLSYCCSIHKSQGSEFKMVILPMVHQYQRMLQRNLLYTAVTRSKELLILLGE
EQAYVTCVANESASRMTTLKSRIMDNDKMNITLRTKLAAYEDSLVGNDPFEDGNYTKEPR
VVKEKLPVEDDSGTNETKNQVMETVEPDLFSSFVGEEKKEEVEPAVSKDFVLTAEVIDNQ
LVDPMIGMENSSPYDFIPAKNA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagaagaaatgccttatttcgttggtacagttgccgcgattttttttcaaaat
cctagtaatttttacaaagtgcttttggtacacatcagtgaaaccacagctgattaccgt
gaaaaagagattgtagtcaccggaagtttcggcgatattcaagaaaatgagacttatcgt
ttttatggagaattagtggatcatcctaaatacggaaggcagcttaaactcgaaagatat
gagcaagaaaagccaacaactgcaaatgggatcgtagcgtatctttccagcgaaaaattc
ccaggaatcgggaagaaaacagcagaaaaaattgtagaattgctgggagaagatgctatc
gaaaaaatcattgctgatccttcggtattaaaacaaatctccggtttgacgaagccaaaa
agagaaatgcttgctgagacgattcggctaaaccacgggatggatcaagtgatcatggga
ctgaatcgttacgggttcggtagtcagttagctttcagtatctaccaggcctataagaac
gagtctttggatatcatcgaagaaaatccgtaccagctagtcgaagacatagaaggaatc
gggttcaaacgtgcagataatctagccgaacaaatcggtattgcagcagattcaccgaga
agaattcgagcagctatcttgcatcagatttttcagcatgcagttcaaacaggagataca
tacgtaccggcggagacattgcttcagcaaacgatccgtattttagaaacaagtcgccca
attgaaatccagcctgatcaggttgctactgtaattatccaacttgttgaagaaggaaag
atacaacaagaagagactaatctttacgaaaacagtttgtacttttctgaatgggggatc
ggtaattcgatccagcgccttctcagtcgtaaaaaagaaatccattatcctgaaaaagaa
gtgcagaagaatattcggcgtatcgaaaaaatattcggcatacagtatggaccttcgcaa
gaacaagctatcgctgaagcaatccgttcccctctatttattttaacaggaggaccaggt
acggggaaaactactgtgatcaacggaatcgtcaatctttttgcagagttgaacggactg
gaattggatccttcaaaatatacccaagaaatttttcctattctacttgcagcaccaact
ggccgagcagctaaacgaatgaacgaaacgacaggtctgcctgccagtacgatccatcgt
cttctggggctgaatggacgggaaaaaacaccttcagtcagtacgaaagaattagaaggc
ggacttttgattgttgatgagatgtctatggtcgatacatggctggctaacacattattc
aaagcgattccgacgaatatgcaagttatcttagtaggagacaaagatcagcttccctct
gtcggtcctggtcaagtactccatgatcttttggaaatcgaacaaattcccaaaatggaa
ctcaatcagatttatcggcaaggtgatggttctagtattattcctcttgcccatgagatc
aaagaaggacgtctgccaaaagatttcacaaagaatcaaaaagatcgttcctatttccga
agtgatgcttatcaaattgaacccttgatctctaaaattgtggaaaaagcgaaaaataag
ggattccgtgcacaagatatccaagtattagcaccaatgtatcggggacctgcagggatc
gatgcgttaaataaaatgatgcaggagatattcaatccagggaaacctggaaaaaaggaa
gtacattggaacgacaccgtttatcggataggagacaaagtcctccaattagtcaatact
cccgaattgaatgtattcaatggagatatgggagaaatcacgggtatcatcttggcaaaa
gattctgaagataaagtggatgaattagttatccagtttgatgcaaatgaggtcacttat
aaaagaaacgaatggaataaaatcactctttcttattgttgctcaatccataaatcacaa
ggcagtgaattcaagatggttattttgcccatggtccatcaatatcagcggatgcttcag
cgtaatttgctctacacggcagtgactcgcagtaaggaactgttgattttgttaggggaa
gagcaagcctatgtcacttgtgtagcgaatgaatcagcaagccggatgactacgttgaaa
tcaaggatcatggataatgataaaatgaatatcactctccggaccaaactagcagcttat
gaagattctttggtcggaaatgatccatttgaagatgggaactatacaaaagagccacgg
gttgtaaaagaaaagctacctgtagaagatgacagtgggacgaatgaaacgaaaaaccaa
gtaatggaaacagtggaaccagatctgttttcttcatttgttggagaagaaaagaaagaa
gaggtagaacctgctgtttctaaagatttcgttcttacagcagaagtgatcgataaccag
ttagtagatccgatgattggtatggaaaacagttctccctacgattttataccggcaaaa
aatgcttga

DBGET integrated database retrieval system