KEGG   Enterococcus faecium Aus0004: EFAU004_02638Help
Entry
EFAU004_02638     CDS       T01772                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
efc  Enterococcus faecium Aus0004
Pathway
efc00900  Terpenoid backbone biosynthesis
efc01100  Metabolic pathways
efc01110  Biosynthesis of secondary metabolites
efc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EFAU004_02638 (ispE)
Enzymes [BR:efc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     EFAU004_02638 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFC64718
Position
complement(2700131..2700976)
Genome map
AA seq 281 aa AA seqDB search
MIEKAPAKINLGLDVLYRRQDGYHELEMVMSSVDLADHLFFEEITEDKIIVETNKAFLPV
DERNNVYQAALLLKNKYNIKTGVKIFVKKNIPVAAGLGGGSTDCAAALRGINQLWNLGCS
LEELAEIGLEVGTDVPYCVYGSTAFVGGKGEEIQVLPSMPQCWVVLVKPRMSVSTRTVFR
EVDTQAIQHQDIHGLAEAIREQDYQQMIKKMGNSLEDITGKRHPVIHQIKERMIKYGADA
ALMSGSGPTVFALCQHYSRAQRVYNGLKGFCEEVYLVRTLQ
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgattgaaaaagcgccagccaagataaatttaggactggatgtattatatagacggcaa
gatgggtatcatgagttggaaatggtgatgtcgagcgtagacttggcagatcatctattt
tttgaagaaataacagaagacaaaatcattgtagaaacaaataaagcatttttaccggta
gatgaacggaacaatgtttatcaagctgctttattgctaaaaaataaatacaatatcaaa
accggtgtcaagatctttgttaagaagaatattccagtagcagctggattaggcggagga
agtacagactgtgcagctgctctaagagggatcaaccaattatggaatctgggctgttcg
ttagaagaactggcagaaatcggtttggaagtcggtacagatgttccttactgtgtctac
ggaagtacggcatttgtcggtggcaaaggggaagaaatccaagtattaccttctatgcca
cagtgctgggttgtgttggtcaaaccaagaatgagtgtctctacacgtacagtgtttaga
gaagtagatacgcaagccatccaacatcaagacatccacggacttgctgaagccatccga
gagcaagattatcagcagatgatcaaaaaaatgggaaacagtttagaagatataacggga
aagcggcatccagtcatccatcaaatcaaagagcgtatgatcaagtacggagcagatgct
gcattgatgagtggaagcggaccaaccgtttttgccttgtgtcaacattattcaagagcg
cagagagtatataatgggttaaaaggtttttgtgaggaagtttatttagtacgaaccctg
caataa

DBGET integrated database retrieval system