KEGG   Enterococcus faecium Aus0004: EFAU004_02829Help
Entry
EFAU004_02829     CDS       T01772                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:efc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2896557..2898242)
Genome map
AA seq 561 aa AA seqDB search
MYTKLLQAIYRDSDLSEKTASMIEQKVSVYQQKKGQAGKLHWDEEDIFLITYGDQFFEEQ
QPTLRTFKKFYQKYLADTFRVVHFLPFFPYTSDDGFSVVNYQAINDRLGTWEDIEEMRSE
TRLMFDFVCNHMSAESTWFQEYLNLNDTYKDFFIDLPLDTDTSSVTRPRTSPLLTTFIDK
NGKEKHVWTTFSEDQVDLNFKNPEVLLKMIDILLFYLEKGASFIRLDAVGFLWKELGTSC
IHLPETHKIIQLFRAIADEAAPGTVLITETNVPHKDNISYFGNGENEAQMVYQFSLPPLT
LQAIRSGNTSKLKEWLKTIDFASKKTTFFNFLASHDGIGLNPVRGILPEKTILELVEQLK
KEGARVNYKKNPDGTTSPYEINATYLDALSSPTDTTEWRSKRFLAAHSFLVTLPGVPAIY
IQSVLGSRNDYKGVEKTGENRKINRQKFLLADIEKELQTDPLRTAVYGELTQMLSIRKKE
KAFHPNSLIYLLDSADSFISFIREAKEEKVLVIHNFSNQSAGYLLPKGDYLDLFSGQIIH
CSQERKLIFQPYEYMWLKIIK
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaaaacttttacaagcgatttatcgcgactcagatttgtctgagaaaaccgcc
tctatgattgaacaaaaagtcagtgtttatcagcagaagaaaggccaggcaggcaaactg
cattgggacgaagaagatattttcttgattacttatggggatcaattttttgaagagcag
caaccaactttgcgtacatttaagaaattttatcaaaagtatttggcagatacatttaga
gttgtacatttcttgccatttttcccatatacatctgatgatggtttctccgttgtaaat
tatcaggcaatcaacgaccgtttgggcacatgggaagatatagaagaaatgagaagcgaa
acacggttaatgttcgactttgtctgcaatcatatgtctgccgaaagtacttggtttcag
gaatatttaaacttgaatgatacgtacaaagatttttttattgatttgccactggataca
gatacaagcagcgtgactagaccaaggaccagcccgttacttacaacgttcattgacaaa
aacgggaaagaaaaacacgtatggacgacttttagcgaagatcaagtagacttgaatttt
aaaaatccagaagttttattgaaaatgatcgatattcttttgttttacttagaaaaaggc
gcttcatttattcgcttggacgctgtgggatttttatggaaagaactaggaacttcttgt
atacacctgccagaaacgcataaaatcatccaattattccgtgcaatcgctgatgaagca
gctccaggaacggtattgatcactgagacaaatgtgccacacaaagataatatcagttat
tttgggaatggcgagaatgaagcacagatggtctatcagttttcgctaccacctttgacc
cttcaagcgattcgttcgggtaatacaagtaagttgaaagaatggttaaaaaccatcgat
ttcgcatcgaaaaaaacaactttttttaattttttagcctcccatgacggtatcggattg
aatccggtacgaggtattctgccggaaaaaacgatccttgaattagtggaacagctgaag
aaagagggtgcccgagtaaactacaagaaaaacccagatggaacgaccagtccatatgag
ataaacgctacgtatctagatgcgttaagttctccaacagatacgacggaatggagaagc
aaacgctttttagctgctcattcatttttggtaacgttaccaggcgtgccggcaatttat
attcaaagtgtgctgggaagtcgaaatgattacaaaggcgtagaaaaaacaggagagaat
cgaaaaatcaatcggcaaaaatttttgttagcagatattgagaaagagttgcagacagat
ccattaagaacagcagtatatggtgaattgacccagatgctatctattcgaaaaaaagaa
aaagccttccatccgaatagtttgatttacttactggactcagcagattcttttatcagt
tttattcgcgaagcgaaggaagagaaagtcttagttatccataatttttccaatcaatca
gcaggttatcttttaccaaaaggagattacctagacctgttttctggacaaattatccat
tgcagtcaagaacgaaagttgatattccagccgtatgaatatatgtggctgaaaataata
aaataa

DBGET integrated database retrieval system