KEGG   Enterococcus faecalis D32: EFD32_0038Help
Entry
EFD32_0038        CDS       T02172                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
efd  Enterococcus faecalis D32
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EFD32_0038
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EFD32_0038
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    EFD32_0038
Enzymes [BR:efd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     EFD32_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(46835..47650)
Genome map
AA seq 271 aa AA seqDB search
MRNKLQQAKRIVIKVGTSSLIYPNGNINLKAIDQLAFTLSDLSNQGKEIILVSSGAIGVG
LNKLNLSVRPTTIPEQQAVAAVGQAELMNIYNQRFSTYSQQMAQVLLTRDVIEYPESRNN
VTNTFEQLLKMNIIPIVNENDTVAIEELDHLTKFGDNDQLSAIVCQIVQADLLVMLSDID
GFFSDNPTVNKEATLFSEINEINEDLFQLAGGKGSRFGTGGMSSKLKAAERVLANQQAMI
LANGKQPKIIFEILEGKDIGTLFIKGGHESD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacaaactccaacaggccaaacgaattgtgatcaaagtcggaaccagttctctg
atttatcccaatggcaatattaacttaaaagcaattgatcaattagcctttactttgagt
gatttaagcaaccaaggcaaagaaattattttagtttcttctggcgcaattggtgtcgga
ctgaataaattaaatctatctgtgcgcccaacgacaattcccgaacaacaggcagtcgct
gcagtcggccaagcagaattaatgaacatttataatcagcggttttcaacctatagccaa
caaatggcacaagttttattaactcgtgatgttattgaatatcctgaaagtcgcaataat
gttaccaatacttttgaacaactgttaaaaatgaatattattcctatcgtcaatgaaaat
gatactgtcgcaattgaagaattggatcacttaaccaagttcggggataacgatcaattg
tctgccattgtctgccaaattgttcaagctgacttgttagttatgttatcagatattgat
ggtttcttttcagacaaccctactgtcaacaaagaagccacgttattctctgaaatcaat
gaaattaatgaagacttgttccaattagccggtggtaaggggagccgctttggcactggt
gggatgtctagtaaattaaaagctgctgaacgtgtgttagctaatcaacaggcgatgatt
ttagcaaacggaaagcagccaaaaatcatttttgaaattttagaaggaaaagatatcggt
acgttatttattaaaggagggcatgaaagtgactga

DBGET integrated database retrieval system