KEGG   Enterococcus faecalis D32: EFD32_0043Help
Entry
EFD32_0043        CDS       T02172                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
efd  Enterococcus faecalis D32
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:efd00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    EFD32_0043
Enzymes [BR:efd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     EFD32_0043
Amino acid related enzymes [BR:efd01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   EFD32_0043
Transfer RNA biogenesis [BR:efd03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    EFD32_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
51698..53155
Genome map
AA seq 485 aa AA seqDB search
MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDGEKSQLE
NLAWLGMEWDESPAHPGEYGPYRQSERKEIYQPLIDQLLSSNRAYKCYCTPEELEAEREA
QQARGEMPHYAGTCANLTPSEQAAKEAAGLEPVIRFRVPRNTEYKFDDIVKGEITFESDN
IGGDFVIQKRDGMPTYNFAVAVDDHLMKISHVLRGDDHIANTPKQLMIYEAFEWTPPVFG
HMTLIINSETGKKLSKRDETILQFIEQYRELGYLPEAMFNFIALLGWSPVGEEEIFSQED
LIKLFDEQRLSKSPAAFDAKKLEWINNQYMKQMDLGELTDMCIPYLVADGRVEENPSPEK
IEWLKQLVSLYQPQMSYAAEIVELSNLFFNEHPVLDDAAKEFLQGETVPTVLHAFKEQLE
ALDVFDVPSIKAAIKAVQKETGVKGKNLFMPIRIAVSGQMHGPELGETIELLGKEKALDH
LNKVL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagttcgtgtgcgttacgcaccaagtccaactggacacttgcacattgggaat
gcaagaacagcattatttaactacttatttgcccgccacaatgacggagaatttatcatt
cgtatcgaggataccgaccaaaaacggaacatcgaagacggcgagaaaagtcagttggaa
aacttagcatggttagggatggaatgggatgaatcacctgctcatccgggagaatatggt
ccatatcgtcaatcagaacgtaaagaaatttaccaaccattgattgatcaattattaagc
agcaatcgtgcgtataagtgttattgtacgccagaagaattagaagcagaacgtgaagca
caacaagctcgtggggaaatgcctcactacgcaggcacttgtgcgaatttaacaccttct
gaacaagcagccaaagaagcggctggtctagaaccagtgattcgtttccgtgtgccacgt
aatacagaatacaaatttgatgacatcgtgaaaggtgaaattacttttgagtcagataac
attggtggcgattttgtcatccaaaaacgcgatgggatgccaacgtataactttgccgtt
gcagtagatgatcacttaatgaaaatttctcacgttttacgtggcgatgatcacattgcg
aacacaccaaaacaattaatgatttacgaagcgtttgaatggacaccacctgtctttggc
catatgaccttaatcattaattcagaaactggcaaaaaattgagcaaacgtgatgaaaca
attttacaatttattgaacaataccgtgaattaggttacttaccagaagccatgttcaac
tttattgctttactaggatggtctcctgttggcgaagaagaaatcttctcacaagaagac
ttgattaaattgtttgatgaacaacgcttaagcaagtcaccagcggcctttgatgcgaaa
aaattagaatggattaacaatcaatacatgaaacaaatggacttaggtgaactaacagat
atgtgtattccttatttagtcgctgacggtcgtgttgaagaaaatccatctcctgaaaaa
atcgaatggttaaaacaattagttagcttgtatcaaccacaaatgagttatgcagctgaa
attgtggaactatcaaacttgttctttaatgaacatccagttttagatgatgctgcgaaa
gaattcttgcaaggagaaacagtgccaactgtgttacatgcgtttaaagaacaattagaa
gccttggacgttttcgatgtcccaagtattaaagcagcgattaaagccgtccaaaaagaa
accggcgttaaaggcaaaaacttgtttatgccaattcgaattgctgtttctggacaaatg
catggccctgaattaggcgaaaccatcgaattattaggcaaagaaaaagcattagatcat
ttaaataaagtgttataa

DBGET integrated database retrieval system